KEGG   Scheffersomyces stipitis: PICST_32740Help
Entry
PICST_32740       CDS       T01023                                 

Gene name
SET1
Definition
histone methyltransferase involved in gene regulation
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pic  Scheffersomyces stipitis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PICST_32740 (SET1)
Enzymes [BR:pic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PICST_32740 (SET1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 1055 aa AA seqDB search
MSRHRGFRRERSRYRSFNNNDYEDDDRETNGSTRGSRYPKDSRYSHNDSGNSQSSSVRLS
RVPSGERSPSIASGHGFKSETPDITYSNIPGTDPVTGENSADKNFTKLLHHIDFLGKFPQ
SRDTDVRKNYRVVYDPELDKSLTKEERKSRTKKIRFNGESLPFSERTDPRTANLQFYFQR
PNKKSKKFPFKQLPQPKFAFDKDSLGPAPQTELVVWDLPATTNEVYLTNYFKSYGDPIQD
MKFVNDPINAVPLGIATFKFQGPPEKAMRLAKKLISIIRVEGAKVDGVDLRIALNDNDNN
LLKNKIDLARDKLRASRQKREEEERRRLRRQQEEERAKRDEERKAAAESKRREEEAKVEK
LQHQKTSGKNHSKFKPNTSTLSIRHHNKVVPGVFLPKELVKYIKDRPYIVIHDKYVSAKK
VSSQDIKRALNKYDWTRVLSDRTGFFIVFNSLKECERCFFNEDGKRFFEFRLYMELAIPE
GYDTSSIESAEDLLELQNKKHDILEEATNILIKEFETFLAKDIRERIIAPAVLDLLSHDK
YPKLVEELKAKENASKPTSFVSTNDQLKQSALSILAGRKSQQSQSLPSFKKKVESPTKNK
PLRKSLIPMQHALNYDHDSDEEDEDDSSRSATPAASILKRERSSTVTTVNNEDNEEQPSK
KQKTGLQKSFLYESSSDEEMEDEDVSDGAASTMVINTEELELKDEGDVKKEAEDKAEEDI
DYSKFEARYHPTERKPYTVYAETNLLPTDNFNLDVLQDVLKDEEDIKLAKEVLQETNPPS
SDIRNIDYWAWKQKDISGASQEIVEDAELIEKLDSRLESQSGAFRSDGYRRIPDVDKIEY
LPHRRKVHKPLQTVQHEEVEEEAGNRNNEGTNSAIQSSRVNRANNRRFAADITAQLGNET
EVLSLNTLTKRKKPVSFARSAIHNWGLYALEPIAAKEMIIEYVGESIRQQVAEHREKSYL
KTGIGSSYLFRIDENTVIDATKKGGIARFINHCCSPSCTAKIIKVDNQKRIVIYALRDID
ANEELTYDYKFERETNDAERIRCLCGAPGCKGYLN
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgccacagaggattcaggcgagaacggagtcgataccgttccttcaataataac
gattacgaagatgatgacagagaaaccaacggatctactcgaggaagccgctatcccaaa
gatagtcgatatagccataatgactctggcaactcgcagagctcttcagtcagactctca
agagtaccatctggagaaagatcacccagcattgcctcaggccacggcttcaaactggag
actccagatatcacctatctgaatatcccgggaactgatcctgtgacaggagaaaacagt
gccgacaagaacttcaccaaacttttgcatcacatcgactttttaggaaagtttccccaa
agcagagacacagacgtaaggaaaaattaccgtgtagtgtatgatcccgagcttgacaag
agtctcacgaaagaagaacgtaagtctagaactaaaaaaatcaggttcaacggtgagtcg
cttccgtttctggaaagaaccgatcctagaacagcaaatctccagttctatttccagaga
ccaaacaagaaatcaaagaaattcccctttaaacaattgcctcaacctaaatttgccttt
gacaaagattcattgggtccagctccgcaaactgagcttgtagtctgggacttaccagct
acaactaatgaggtatatttgactaattattttaagagctatggtgatcctattcaagac
atgaaattcgttaacgacccaataaatgccgtgccgttgggtattgcaacgttcaaattc
caaggacctccagagaaagctatgagattggctaagaagcttatcagcattatcagagta
gaaggagctaaagtagatggagtagacctcagaattgcattaaacgataatgataacaac
ttgttgaagaacaagatcgatttggctcgtgataaactccgtgctagcaggcaaaagcga
gaagaggaagaaagaagaaggttgagaagacaacaggaagaagaacgagccaaaagagat
gaagaacgcaaggctgctgctgaatccaaaagacgagaagaagaagctaaggtggagaag
cttcaacatcaaaagacatctggcaagaaccattctaaattcaaacccaacactagcacg
ctttcaattaggcaccacaataaagttgtaccgggcgttttcttgccaaaggaattggtc
aaatacatcaaagatcgtccctatatcgttatacatgacaaatacgtttctgccaagaag
gtttcgtctcaggatatcaaacgtgctttgaacaaatacgactggacaagagtattgtcg
gacagaactggtttctttattgtgttcaacagtttgaaggaatgcgaacgatgcttcttt
aatgaggatggaaagaggttttttgaattcagactttacatggaacttgctattccagaa
ggttatgacactagttctatagagtccgctgaggaccttctagagcttcaaaacaagaaa
cacgacatcttggaagaagcaaccaatattttgattaaggaattcgaaaccttcttggct
aaagacattagagagagaattattgctccagctgttttagatttattgagccacgacaag
taccccaaattggttgaggaacttaaagcgaaggaaaatgcttctaaacctacgtcgttt
gtcagcacaaacgatcagctcaaacagtctgcactttccattcttgccggacgcaaatcg
caacagtctcaatctctaccctcgttcaaaaagaaggtagaatctcctaccaagaataaa
ccacttaggaagagtctcattcccatgcaacatgctcttaactatgatcatgactcagat
gaagaggatgaagatgattctagtagatctgctacaccagctgcgctgatcttaaaaaga
gaacgtagttctactgtaacaacagtaaacaatgaagataatgaagagcaaccgtccaag
aaacagaagactgggttgcaaaaatctttcttatacgagtcttcttcagatgaagagatg
gaggatgaagatgtttcagatggtgccgcgtctacaatggtaattaatacagaggagcta
gaattaaaggatgagggtgatgtaaagaaggaagctgaagataaagcagaggaggacatt
gattactccaaatttgaagctagataccatcctacggaacggaagccttacacagtgtat
gctgaaacgaacttgttacccactgataacttcaacttggatgtcttacaggatgtgctt
aaagatgaagaggatatcaagttggccaaggaagtgttgcaggaaaccaatccgccttcg
tctgacatcagaaacattgattactgggcttggaaacaaaaggatatcagtggtgcttct
caagaaattgttgaagatgctgaattgattgaaaagttggactcgcgacttgaatcacaa
tcaggagctttcagaagcgatggttatagaagaattcctgatgttgacaagattgagtat
ttgccacaccgtcgtaaagttcataagccacttcaaacagtacagcatgaggaagtggaa
gaagaggctggtaatagaaataatgaaggtaccaatagtgctatccaaagttcacgtgtc
aaccgtgccaacaatagaagatttgctgcggacattacagctcagcttggtaatgaaacc
gaagtgttgagtttgaatacgttgaccaagagaaagaagccggtgtcttttgcccgttct
gccattcataactggggattatacgccttggagcctatagctgctaaggaaatgattatc
gagtatgttggtgagagtattagacaacaggtagcagagcatcgtgagaagagctacttg
aagactggtattgggtcgtcgtatcttttcagaatcgacgagaacacggtcattgacgca
acaaagaaaggaggcattgctagattcatcaaccattgctgtagtcctagttgtactgct
aagattatcaaggtagacaatcagaagagaattgtcatttacgccttgagagatatcgat
gccaacgaagaattgacctacgactacaaattcgagagagagaccaatgatgctgagagg
atcagatgtttgtgtggagcacctggttgtaagggctatttgaactaa

DBGET integrated database retrieval system