KEGG   Scheffersomyces stipitis: PICST_32846Help
Entry
PICST_32846       CDS       T01023                                 

Gene name
EHO3
Definition
enoyl-CoA hydratase, mitochondrial (EC:4.2.1.17)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pic  Scheffersomyces stipitis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_32846 (EHO3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PICST_32846 (EHO3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PICST_32846 (EHO3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PICST_32846 (EHO3)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PICST_32846 (EHO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 475 aa AA seqDB search
MSPVDTNTGHAEDTVLFSNKNASRIVSLNRPRKLNSLNTEMMELMAPRLKEYSKSSSNNI
VILTSNSPKGLCAGGDVAECASQILKGNAEYASDFFQKEYNLNYVISTYPKPFVSLMDGI
TMGGGVGLSVHAPFRIATEKTKLAMPEMDIGFFPDVGTTFFLPKLDDKLGYYYALTGKIL
SGYEAYFSGFATHFVHSDKLPHLVNRLSNLQPPIINDNKTASADVITNTSEYFAQVNQAI
EEFTENKPPKDYVFPYTAKELKVINEAFSQKSFEDVISYFKQEGSQFSKDTLHIFSQKPY
SSLKIAFELLNHGSENSIKKQFELELISATNIMNIEPKENDFVKGVSHKLIEKIKNPSHP
HWNEVSTITDEYVQKILSPSPKTAALKQPLIDTHFGIDYKNYPFHNGLPNNQQVADYITG
NDGSNRAYLPTPTEVVKHFVKQTNNKVGVEEKVELILSVHGSSSTYDNKYVSWKQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctgttgataccaacaccggccatgccgaggacactgttctcttttctaacaag
aacgccagcagaattgtctctttaaacagaccccgcaagttgaactcgttgaacacggaa
atgatggagttgatggccccacggttaaaggagtactccaagctgagttccaacaacatc
gtcatcttgacttccaactcaccaaagggtctctgtgctggtggagatgtcgctgaatgt
gcctcacagatcctcaaaggcaatgctgaatatgccagtgactttttccagaaggaatac
aatttgaattacgtgatctctacctaccccaaaccatttgtctcattgatggatggtatc
actatgggaggtggtgtcggcctttccgttcatgctccctttagaattgctacggaaaag
accaagttggccatgcccgaaatggatatcggcttctttcctgatgtcggcacaacattc
ttcctccccaagttggacgataagctcggctactactacgccttgaccggcaagatattg
tctggctacgaagcctacttctccggattcgctacccatttcgtccattctgataagctt
ccacatttggtgaacagattgtcgaacttgcagcctccgatcatcaacgacaacaagacg
gcctctgctgacgtcatcaccaacacctctgagtattttgcccaagtcaatcaggcaatc
gaggagttcacggaaaataagccccccaaggattatgtgttcccttatactgcgaaggaa
ttgaaggtgatcaacgaagctttctcgcagaagagctttgaagatgtcatttcatacttc
aaacaggaaggctctcaattctccaaggatactctccatatcttcagccagaagccatat
tcttcgctcaagatcgcgtttgagttgttgaaccacggttcagaaaactcaatcaaaaag
cagttcgagttggaattgatctcggctaccaatatcatgaacattgagcccaaggaaaac
gattttgtcaaaggagtgtcccataagttgattgaaaagatcaagaaccctagccatcca
cactggaacgaagtttctactattacggatgagtacgtgcagaagatattgtctccttct
cccaagactgccgccttgaagcaaccattgatcgatacccattttggcatcgactacaag
aactaccctttccacaacggtttgcccaacaaccagcaggtagctgactatatcaccggt
aacgatggcagcaacagggcttacttgccaacacctactgaagtcgtcaagcactttgtc
aagcaaacaaacaacaaagttggtgtagaagaaaaagtggagttgatcttgagtgtccat
ggctctagctctacctacgacaacaaatacgtttcgtggaaacagtaa

DBGET integrated database retrieval system