KEGG   Scheffersomyces stipitis: PICST_32904Help
Entry
PICST_32904       CDS       T01023                                 

Gene name
LAG1.1
Definition
Acyl-CoA-dependent ceramide synthase (EC:2.3.1.24)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pic  Scheffersomyces stipitis
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PICST_32904 (LAG1.1)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PICST_32904 (LAG1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 417 aa AA seqDB search
MSKPDPVSHLSPQISGSDTHIHRRRGSSVGEINIGDTASPGLSTMHTSKRQRKMSDARII
ALSRESSSDTAILKKIVIASRELCYRHTWIVPLLVLIASYSTYWLSGVDTPVHRFLEALV
VPSYKIPGTDQYGKGENDFYFVGFYAIFFTFLREFVMVCALRPLAHILGVKKEAKVKRFM
EQAYAIFYYGISGPAGLWIMSTLPLWFFEITPFYVNYPHKTHDFYFKIYYLGQAAFWVQQ
SVVLILQLEKPRKDFKELVLHHIITIALIWCSYRFHFTWMGLEIFVTMDVSDFFLATSKT
LNYLDYAIAGPFFIGFVFIWIYLRHYVNIRILWSVLTEFRTVGEWELNWDTQQYKCYISQ
PIVFFLIGALQIVNLYWLFLIFRILWRYAVGGVAKDERSDDESETEESSEEESKKYE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccagatccagtatcccatctttcccctcaaataagcggcctggatacgcat
atccaccgtcgccggggttcttctgttggagaaataaacattggtgatacagcttctcca
ggtctttccactatgcatacttcgaaaagacagagaaagatgtctgatgcaagaattatt
gctttgagtcgcgaatcaagttcagatactgcaatattgaagaaaattgtcattgcttcc
agggagttgtgttatagacatacttggatagttccactcttggtattaattgcatcatac
agtacttactggttgtctggtgtcgatactccagttcatcgtttcttagaagctttagtt
gttccatcctacaagattcctggaactgatcaatatggaaagggtgaaaatgacttttat
ttcgttggtttctacgctatattttttactttcttaagagagttcgtaatggtgtgcgcc
ttgagacctttggcacatattttgggtgttaaaaaggaggctaaggtaaaaagattcatg
gagcaggcctatgctatcttttattacgggatatcgggtccagccggattatggataatg
tcaactttaccactttggttctttgagattactccgttctatgttaactatccgcacaag
actcacgatttctatttcaagatctattatttaggtcaagccgctttctgggttcaacag
tcggttgtattgattttacaattagaaaagcctcgtaaggatttcaaagaattagtgttg
catcacattatcactattgcattgatttggtgttcgtacagatttcacttcacttggatg
ggcttagaaatatttgttactatggatgtttctgatttcttcttagctacatcgaagacc
ttgaactacttagactacgccattgctggtccattcttcattggttttgtcttcatttgg
atttacctcaggcactacgtgaacatccgtatcttgtggtctgttttaactgaattcaga
actgtcggtgaatgggaattaaactgggatacgcaacaatacaagtgctacatttcccaa
ccaatcgtctttttcttgattggtgcattgcagatagttaacttatactggctcttctta
atctttcgtattctttggagatacgccgttggaggtgtcgcaaaggatgaaagaagtgac
gacgaatctgaaactgaagaaagtagtgaagaagaatccaaaaagtacgaataa

DBGET integrated database retrieval system