KEGG   Scheffersomyces stipitis: PICST_33003Help
Entry
PICST_33003       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 366 aa AA seqDB search
MVVFNVSQSFKVVRVLGEGAYGIVSLAIHVPTGTQVAIKKIEPFDKPLFCLRTLREIKLL
SRLSNHENIVQLYDVQQPQDFNSFKEVYIIQEYMPTDLVNVIESQILSEEHVQYFTYQIL
RGLKLIHSAGVIHRDLKPSNILINENCDLKICDFGLARLDVSHPNSSKIPKKGGISALTE
YVATRWYRAPEIMLNSAQYSSEIDVWSVGCILAEMLTYRPLFPGKDYQNQLQLILQVLGT
PMGEDFHSIKSARARSFIKSLKHQVRLDFADLCNNHPSRLQRHGRRKISPQGIDLLERML
AFNPDKRISVDEALSHPFVSRYHDPNDEPTTTPIAAEEFDFDVEKDKLDTMELKRQLYRE
IKQLRG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgtttaatgtctcgcaaagctttaaggtagttcgggtgttaggtgaaggggcc
tacggtattgtttcacttgctatccatgtacctaccggcactcaggttgcaatcaagaag
attgagccatttgataagcctctcttctgcttgcggaccttgagagaaatcaagctattg
tctcgtctcagtaaccacgagaatatcgtacaactatatgatgtgcaacaacctcaagac
ttcaactctttcaaggaggtctacataatccaggagtatatgcctactgacttggtaaat
gtgatcgagtctcagattctcagtgaggaacatgttcagtacttcacctaccaaattttg
agagggctcaaactcatccatagtgctggtgttatacacagagatttaaagccgtccaat
attcttatcaacgagaattgtgacttgaaaatctgtgatttcgggttggctcgtttggat
gttctgcacccaaattcgtcgaagataccaaaaaaaggaggaatatcggcattaacagag
tatgttgctactagatggtatagggctccagaaatcatgctcaattcggcccagtattca
tctgaaatcgatgtttggtctgtaggctgtattcttgcagagatgttgacttatagacct
ttgtttccaggcaaagactatcagaaccagttgcaattgattctccaagttttgggaact
cctatgggagaagatttccatagcatcaaatctgccagagcaaggagcttcataaaatcc
ctaaagcatcaagttcgtttagattttgcagacctttgtaataaccatccttcaagattg
caaagacacggcagaaggaagatcagccctcagggaatagatctcttagagaggatgttg
gccttcaacccagacaaaagaatatccgtagatgaagctttatcacatccatttgtttcc
agataccatgatccaaatgatgaaccaacgacaacgccaatagcagcagaagagtttgac
ttcgatgtagaaaaagacaagctagataccatggagttgaagaggcaattatacagagaa
ataaaacaactaagaggctag

DBGET integrated database retrieval system