KEGG   Scheffersomyces stipitis: PICST_33075Help
Entry
PICST_33075       CDS       T01023                                 

Gene name
PNC1
Definition
NAD(+) salvage pathway gene (EC:3.5.1.19)
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
pic  Scheffersomyces stipitis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PICST_33075 (PNC1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PICST_33075 (PNC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 235 aa AA seqDB search
MSQRKVALAVIDLQEDFLPPHGSLAVAQGRSVIPLINDLVTNRQFKWSAVIATQDWHPSD
HTSFASQHGVAPFTELEFKHPLDEKDPVTNEVIIKKQVVWPDHCVQESSGACIDASFLGN
FNSISPNIVKTVVKKGYLSDREYYSCFQDTWGLHHTEMEKFLRDNKITDVIFVGLAYDYC
VFNSAKDSAADGFNTYVLKKCCKSVYPEKEAETDELYRKANVTIIEDDSYVDLLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacgcaaagttgccctagcagtcattgacttgcaagaggatttccttcctcca
catggttctctagctgtagcacaaggaagatctgtgattccactcatcaatgacttagtg
acaaatcgccaatttaaatggtcagctgtcattgctactcaagactggcatccaagtgat
cacacatcgtttgcctcccaacacggggttgctccgttcacagaattggaatttaagcat
cctctagatgaaaaagatcccgtgaccaatgaggttataattaagaaacaggtagtctgg
ccggaccattgtgttcaagagtcaagcggtgcatgcatagacgctctgtttctcggcaac
ttcaatctgataagtcccaatatcgttaagacagttgtgaagaaaggctacttatctgac
cgagaatactactcctgtttccaagatacatggggtttgcaccataccgaaatggagaag
tttctccgggataacaaaattaccgatgtaatattcgtcggtttagcctacgactactgt
gtatttaactccgccaaggatagtgctgccgatgggttcaatacttatgtgctcaaaaag
tgttgcaagagtgtatatcctgaaaaggaagccgaaacggacgagctatatcgtaaggca
aacgtcaccatcatcgaagacgactcgtatgttgatctcttgaaatga

DBGET integrated database retrieval system