KEGG   Scheffersomyces stipitis: PICST_33151Help
Entry
PICST_33151       CDS       T01023                                 

Gene name
TOR2
Definition
(RefSeq) 1-phosphatidylinositol 3-kinase (EC:2.7.1.137)
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Regulation of mitophagy - yeast
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pic00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    PICST_33151 (TOR2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    PICST_33151 (TOR2)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PICST_33151 (TOR2)
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PICST_33151 (TOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 2483 aa AA seqDB search
MSSTQLQVVDGVALAQIFNGLKSAKDDDRTRYAVELRNYLESIARDLSPEQFNRYNNEIN
KTIFELLHGKETSEKLGGIAALNALIDFDSGVGEENATKTARFSNYLSSLILSNDLVIMK
QSTKTLGKLATPGGALTGDFVDSEAKRAMEWLSSDNKQHENRRHAAILIITALADNAPTL
LYNYISQILDHLWVPLRDHKLIIREDTAKALQKSMHIIYDRDINARTYWIKKMIDMASKI
LNENDSVDYSDANAPSAYNLIASTTSQSNESIHGSLLVYRELIRYHKDPYIISKFEQIYE
NTMLYKNHKLAIIRQELTNIFPLLCKVNPELFVEKYLHRTLYYYLSQLKKLKNSHNETSN
SDKSAIFRSIGLISLEVGNQMATYLDAILDNIREGLSYATNSSVQSILVNAVSSDSNAPT
AAGINTISTSSANSSKYRASRKETEPAIFDCIGKLSIAVGPALTKHLQRDILDMMFTNCS
LSTHMQVVLQILITNIPTLTNLINMKLLNLLSFVLSGKSFQPPGSPYGSVKMNDSLARDY
RLLMISRDTGSSINSILSNNETYKAYDGAILIQALEMLAAFKFENYQLNEFIRYCTITYL
EHSDAKVRQTATVTSCEIFVKDPICQQTSVNALNAVNEVLDKLLSISITDPIPEIRLEGL
NCLGDAGNFDPQLSQADNVRLLFIALNDEVFSIRKTAIRILGRLSSINPAYIVPSLRKTL
IQLLSRLDYSSTSRKKEESAILLSLLISNSKELTRPYVKPIVETLLPKAKDLSSSVASSA
INCIGELAVVGGEDLKSFIPDLMPLILDTFQDQSSSYKRDAALKTLGQLASSSGYVIQPL
LEYPQLLGMLVGILKSETSPQIRRETVRLLGILGALDPYKYREVEQNSKNIPVEQNAPPV
DVALLMQGMSPSNDEYYPTVAITNLLKILKDTSLSTHHTKVIQAIMYIFQTLGLRCVSFL
PQIIPGIINVMHTCQPSMLKFYFQQLGALILIVKQHIRPFLSEIFEVIKEFFNVNSQLNI
QVIIISLIESISRALDGEFKMYLPDVLTLMLDVFEEDKSPKREPTLHVLKSFVVFGSNIE
EYVHIIVPNIVKMFEVGPFNLRKAAIETIGRLSRNVLLNDMASRIIHPILRVLRQGNDEL
RGTAINTLSYLLLQLGSEFSVFIPVIKKVLIQQKIHAPKFEQLVGKLISGDPLPPHLDIY
KDYDSHSPHFDISDVDLPSKKLPVNQGALKTAWDCGQRRSKEDWQEWIGRLSKELLKQSP
SHAIRACARLASDYYPLAKDLFNASFASCWSELYSQHQEELVQSFCVALSSPNNPPEIHQ
ILLNLAEFMEHDDKSLPIAITTLGQYAQRCHAFAKALHYKELEFYEEPTTPTIESLISIN
NQLQQSDAAIGILKHAQLHHDLQLKETWYEKLQRWDDALRAYNEREKHEPNNMEITMGKM
RCLHALGEWEQLSELARSKWDDSSSDIKRSVAPLAAAASWGLGQWDRMDSCIKVMKSESP
DKAFFNAILSLHRNNFEDASNHISKARDLLVTEITALVSESYNRAYGVVVRVQMLAELEE
IIKYKCLPQGSEKRAVMRKTWNTRLLGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFAN
LCRKSGRLNLAEKSLNSLLEEGSPENPSRAPPQVVYAQLKYMWAKGQQKEALRHLVDFTT
RMSQDLGLNPNDLITQPLPSEGPGIPKHVEEYTKLLARCFLKQGEWQIALNNNWRTETSE
IILGAYLLATHFDNKWYKAWHNWALANFEVISVYTTQSNTSSSAGNSNFGSQGDIVEQND
QIKLSSAQETGANPKLQPANMIPMEAVQRHVIPSIKGFFHSIALSSSNSLQDMLRLLTLW
FKFGGIPEAAQAMTEGFNMVKIDNWLEVVPQLISRIHQPNQIVSRSLFGLLADLGKAHPQ
ALVYPLAVAVTSESVNRKMAAESIIEKMRLHSSNLVDQAELVSHELIRVAVLWLEQWYEG
LEDASRLFFGEHNTEKMFEVLEPLHQMLAKGPETMRESSFATAFGRELADAYEWVLNFRR
TKDITNLNQAWDIYYNVFRRISRQLPQLQSLELQYVSPKLESANNLDLAVPGTYQAGKPV
IRIMGFNPTFSVISSKQRPRKVTCGGSDGKDYFYALKGHEDIRQDNLVMQLFGLVNTLLV
NDPECFKRHLDIQQYPAIPLSPKVGLLGWVPNSDTFHVLIREYRESRKILLNIEHRIMLQ
MAPDYDSLTLLQKVEVFTGALDNTRGQDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMV
GYILGLGDRHPSNLMLDRITGKVVHIDFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVS
GIEGSFRITCEHVMRVLRDNKESLMAILEAFAYDPLINWGFDFPTKAVAEATGIKVPQVN
AAEMLRRGQIDEQEAAKLQRQNEVEIRNARAALVLKRITDKLTGNDIKRLKGLDVPTQVD
KLIQQATSVENLCQHYIGWCSFW
NT seq 7452 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacccaattgcaagtggtcgatggagttgcgcttgcgcagattttcaacggg
ctcaaatcggccaaagacgatgatcgtactcgctatgctgtagaattacgtaactatttg
gagctgatcgcgcgcgatctctcgccagagcaattcaaccggtacaacaacgaaatcaat
aagacgatttttgagttgctccacggtaaagagacatctgaaaagcttggaggtatagct
gctttgaatgcacttattgactttgactctggagtaggcgaggaaaatgccaccaagaca
gcccggttttccaactatttgagttctttgattcttctgaatgacttggtgattatgaaa
cagtctactaagacgttaggaaaattggcgacgcccggaggagctctcactggtgatttc
gtggattcggaagccaaaagagccatggaatggctcctgtcggacaacaaacaacacgaa
aaccgtcgtcatgcagccatattgatcataacagccttagcagataatgctccaacattg
ttgtacaactatattagccagatcttggatcatctttgggttcctcttcgtgatcacaag
ttgataataagagaagataccgccaaagcactccagaagagtatgcacataatctatgac
agagatatcaatgctagaacatactggattaagaagatgatcgatatggcactgaaaatt
cttaacgaaaatgatagtgtagactacagcgatgcgaatgccccttctgcgtacaactta
atcgcttcgacgacgtcgcaatcgaatgaaagtatccacgggtcacttctagtgtaccgt
gagttgatcagataccacaaagacccctacatcatttccaagtttgagcagatatacgaa
aataccatgctctacaaaaatcacaaactcgccatcataaggcaggagttgaccaacatc
ttccccttactctgtaaggtcaatcccgagctttttgtggagaaatacttgcatcgaaca
ctctactactatttatctcagctcaagaagctcaaaaatctgcataatgaaacttccaat
tcggacaaaagtgccattttccgaagcatcggcctcatatctttggaagtgggtaaccag
atggcgacttacctagatgccatccttgataatatcagagaaggcttatcgtatgccacc
aactccagcgtccagctgattcttgtcaatgctgtatccagtgacctgaatgctcccact
gctgctggtatcaataccatctctacttcctcggcaaactcttccaaataccgtgccagt
cgtaaagaaacagaaccagctattttcgactgtataggcaaactctctattgctgtagga
cctgcattaaccaagcatttgcaaagagatatcttggacatgatgttcaccaactgctct
ttgtcaactcacatgcaagtagtgttgcaaatcctcatcactaacattccaactttgact
aacttgatcaacatgaagttactcaacttgcttagttttgtcttgtcgggaaagagcttt
cagcctccaggatctccctatggatcagtcaagatgaacgattccctagcaagagactac
agacttttaatgatttcaagagatactggatccagtattaacagtattcttctgaataac
gaaacttacaaggcgtacgatggagcaattttgattcaagcacttgagatgctagctgcc
ttcaaatttgaaaactatcaacttaacgagttcatcagatattgtacaatcacatatttg
gaacacagcgatgccaaagttagacagacggctaccgttacgtcatgtgaaatctttgtt
aaggatcccatttgccaacaaacaagtgtaaacgcgctcaatgctgtcaatgaagtcttg
gataaactcttgtctatctcgattactgatccgattccagagatccgattagaaggtctc
aattgcttgggcgatgctggcaatttcgatcctcaattgtcacaagctgataatgtgaga
ctattattcattgcattgaacgatgaagtattcagcatacgaaaaactgccatcagaata
ttaggaagattatcttccattaaccccgcctacattgtaccttcattgaggaaaacgctc
attcagttgttatccagattagattactcctctacaagtcggaaaaaggaggaaagtgcc
atattgttgtccttgctcatcagcaactcaaaggagttgacaaggccatacgtgaaaccc
attgttgagactttattgccaaaagcaaaagacttgagctcctctgtagcatctagtgca
attaattgtattggggagttggctgttgtaggaggagaagatttaaagagtttcattcct
gatttaatgcctttgattttggacactttccaggaccaaagttcatcatacaaacgtgat
gccgcattgaagaccttggggcaactagctagttcttctggctacgttattcagcctttg
cttgagtatccgcagttgctaggaatgttagtaggaatcttgaaactggagacttctcct
caaattaggagagaaactgtcagattgcttggtatcttgggtgctcttgatccatacaag
tatagagaagtagagcaaaactccaagaatatccctgttgaacagaatgctcctccggta
gatgtagctctccttatgcaagggatgtcaccatccaatgatgaatactatcctacagtt
gcaatcactaacttattgaagattctcaaagatacttcattgagcactcaccacacaaag
gtaatccaagctataatgtacattttccagactttgggattgagatgtgtttcgttttta
ccacaaatcattcctggtattattaatgttatgcatacgtgccaaccctcaatgctaaag
ttctatttccaacagttgggagctttgatattgattgttaaacagcacattagacctttc
cttctggagatttttgaggtcataaaggagttcttcaatgtgaacagtcaattgaatata
caggtcatcatcattagtttgattgagtccatttcgagagctttagatggtgagttcaag
atgtatttaccagatgtcttgacgttaatgttggatgtgttcgaggaagacaagtctcca
aaaagggaacctaccttacatgttttgaagagttttgttgtctttggaagcaacatagaa
gaatatgtgcatataattgttccaaacattgttaagatgtttgaagtaggaccgttcaac
ttgcgtaaggctgccattgaaacgattggaagattgtcaagaaacgttttattaaatgat
atggcttctagaattattcaccccatattaagagtgttacgtcaagggaatgatgaatta
agaggcactgctatcaacacattaagctacttgttgttgcaattaggatccgaattcagc
gttttcattcctgttattaagaaggtgttgattcaacagaagatacatgctccaaagttt
gaacaattggttggaaagcttatcagtggagatcctttgcctccacatttggacatttac
aaggattatgattcacacctgcctcattttgacatctcagatgtcgacttaccttccaag
aaattgcctgtgaatcaaggagccttgaagactgcttgggattgcggccagcgcagaagt
aaagaagattggcaagagtggattggaagattgagtaaggaattgttgaaacaaagtcct
tctcatgcaatcagagcctgtgctcgtttagcatcggattattacccattggctaaggat
ttgttcaacgccagttttgccagttgttggagtgaattgtattctcagcatcaagaagaa
cttgttcaatcattttgtgttgcattatcttcaccaaataatccgccagagattcatcag
atcttgttaaacttggctgaattcatggaacacgatgataaatcgctacctatagcgatc
actactttaggccagtatgctcaacgttgccatgcttttgccaaggcattgcattataag
gaacttgagttctacgaagagccaacgacgcctaccattgagtcattgatcagtatcaat
aaccaattgcaacagtcagacgcagcaatcggtattttgaagcatgctcaattgcaccac
gacctccaattaaaggaaacatggtatgagaagttgcagcgttgggatgatgctctcaga
gcgtataatgaacgtgagaagcatgagcctaacaacatggaaataaccatgggtaagatg
agatgtttacacgcgttgggagagtgggaacagttatctgaattagcacgcagtaaatgg
gacgactcatccagtgacatcaagagaagtgtagcaccattagcagcagctgcttcttgg
ggtttgggccaatgggatcgtatggattcttgtatcaaggtaatgaagtctgagtctcct
gataaggctttcttcaacgccatcttgtctctacacagaaacaacttcgaagatgcatcc
aatcatatctcgaaagctagggatttgcttgttactgaaattactgcattggtcagtgaa
agttataacagagcatatggcgtggtagtcagagtccaaatgttagctgaattggaagaa
atcattaagtataagtgcctaccacagggttcggaaaagagagctgttatgagaaagact
tggaatacgagactcttaggatgtcagcgtaatgtagatatttggcaaagaatgttgaag
gtgagagctctagttatcaagccaaagcaagatatggacatgtggatcaaatttgccaac
ttgtgccgtaaatctggaagattgaatttggcagaaaagtccttgaattccttgttagaa
gagggatctccagagaacccttccagggctccaccacaagtagtttatgctcagcttaag
tatatgtgggctaaaggacaacagaaggaagctttacgacacttagttgatttcacgacc
agaatgtctcaagatctcggattgaatccaaacgatttgatcacccaacctttgccgtct
gaaggcccaggtattcctaaacatgtagaggaatataccaagttgttagcacgttgtttc
cttaagcagggtgaatggcagattgccttaaataacaactggcgtactgagacctctgag
atcattttaggtgcctatcttttagccactcatttcgacaacaagtggtataaggcatgg
cataattgggctcttgccaattttgaggttatctctgtttacactactcaaagcaatact
tcttctagcgctggtaacagcaatttcggaagtcaaggtgacattgtagagcaaaacgat
caaatcaagctttcctctgcacaagagactggggcaaatccaaaattacaaccagcaaat
atgattcctatggaagcagtgcagagacatgttattccttccattaagggtttcttccat
tctattgcgttgtcaagttctaactcattgcaagatatgttgagattactcacgttgtgg
ttcaagtttggaggcattcctgaagcagctcaggcaatgactgagggcttcaacatggtt
aaaattgacaactggttagaagttgttccccaacttatctcgcgtatccatcaaccaaat
caaattgtgagtaggtcgttatttggcttgctcgctgatttgggtaaggctcatccacaa
gcattggtgtatcctttagctgttgccgttacctctgagtcggttaacagaaaaatggct
gctgagtcgatcatagagaaaatgcgtcttcattcatctaacttggttgatcaggctgag
ttggtctctcacgaattgatcagagtggcggtcttgtggttagaacagtggtatgaaggt
ttagaagatgcttccaggctattctttggtgaacataatactgagaagatgttcgaagtt
cttgaacctttacatcagatgttagcgaaaggacctgaaacaatgagagaatcttcgttt
gctacggcttttggaagggaattggcagatgcctatgaatgggtgttgaatttccgcaga
actaaagatatcactaatttgaaccaagcatgggacatttactataatgttttcagaaga
atcagtaggcagttaccacaattgcaaagtttggaattacaatacgtttctccaaaatta
gaatctgctaacaacttggacttagccgttccaggtacttatcaagcaggcaagcctgtc
attagaatcatgggatttaatcctacattctcggttatctcttcgaaacaaagaccaaga
aaggttacctgtggcggtagcgatggtaaagactacttttatgccttgaaggggcacgaa
gacatcagacaggataacttggttatgcaattgtttggtttggtgaatactttgttggtc
aacgatccagagtgttttaagagacacttagatatccagcaataccctgcaattccgttg
tcgcctaaggtgggtttattgggttgggtacctaacagtgacactttccatgtgttgatc
agagaatacagagaatctagaaagatcttattgaatattgaacacagaattatgttgcaa
atggctcctgattacgacagcctaactttgctacagaaggtggaggtattcacaggagca
ttggataacacaagaggacaagacttgtacaaggtattgtggttaaaatcgaaatcttct
gaggcttggttagaccgtcgtacgacttatacacgttcgttggcagtaatgtctatggtt
ggttatattttgggattgggagaccgtcatccctcaaacttgatgcttgacagaatcact
ggtaaggttgttcatatcgattttggtgattgtttcgaagctgctattctcagagaaaag
tatccagagaaggttcctttcagattgactagaatgcttaattatgctatggaagtaagt
ggaattgaaggatcgtttagaataacatgtgaacatgtgatgagagtcttgagggataac
aaagagtccttgatggctatcttggaagcctttgcctatgatccattgatcaactggggg
ttcgatttccccaccaaagctgtagctgaagcaactggtatcaaggttcctcaggttaat
gcagctgagatgttaagaaggggacagattgatgagcaggaagctgccaaattacaaaga
cagaatgaggttgaaatcagaaatgccagagctgctttagtattgaagagaattacagac
aagttaactggaaatgatataaagagactcaaaggattagatgttcctacacaagtggac
aaattgattcaacaagccaccagcgttgaaaacttgtgccaacattacattggctggtgt
tcattctggtag

DBGET integrated database retrieval system