KEGG   Scheffersomyces stipitis: PICST_33358Help
Entry
PICST_33358       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PICST_33358
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PICST_33358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 1546 aa AA seqDB search
MKDSTEALNSIAFAVDTTLSSILPSSLAPPSAPPATSSFLKSIWYAFWWLWSMVVFKIMN
IILLYIPSKIMNALSINFEITLNLSSILVALSAIITVCFLVVRYKYLTGYSKDTSDRKTK
GKVNPSASNINLKNQSLDYVDQKKGHRRTTNYLDEFLSAIKVFGYLEKSVFHELTKNMTT
QKLSHDEILYLDEKLGFSIVVEGVMQVYTRITENSNVSGGFDPDDDNELNYEKDDVLIIG
NQRYQLLNEVKSGAPLSSLVSVLDLLKPVDSEDSTSDMLHSFNISDDDNISKIPEISPIS
LPFQGIHAGAKDDSVPPSPIIRPSKTKQLYPEIVARPKSRPHKEHTGHHLHHVHHSGATI
AIIPYSAFQRVQSKYPKATSHIVTMVLARLYKVTFNTIHDYLGLTKEIMESEVKLNTTSS
VRGANLPGYLFDGLLDKIYGANGINEASLSRKSDFQRASSVNLNKQKTTLCDAKSSRYVL
LDSRLKSTHPGDLLSSVPLSRRSDYYQTHSHPLSADDPLVRSAFPSSKTLSSLSSPTSNL
KRASSNLKFENIRDRSFSDDREETEETSLRIAVVESIFKILGISEKSTAMRNLSSFNSGR
SSVSSSIVGLSNLMSADDKFDTNAARVRFDSYNGFSSTATSISRSSTPIKFYNTINQNQL
HNHHMGDSVSGINISTLSRQHQANRNSSPTEFNFANVKSDFAKCLEIKSYGPNTTIVEQG
SFNSGLYYVIDGSLDVLYRPSNHGEPSSNREDNLKKLYSVKSGGVAGYLSSVVGFRSLVT
IRTSKKRGVIVAHISKSDYSKLMDRYYFLQLPVATKLKKLLSPQILTIDYALEWCHIPAG
GVLCSQGDLANGFHIVLSGRFRVVRNKSDRYQGNTSDDDILGFSDTSMDCSPSSDINNED
LEVLGEYGHGESIGEVEVLTASRRTNSLIAVRDSETARIPRTLFEMLSLSNPSIMVKVSR
IVASKVVYKDVLDQSSRNSTLIPSSTASHISNDYKTITILPTVSGLPVREFADKLVSALK
AIGRNVIALDQASTLTHLGRHAFDERLAQLKLSGYFAYLEEEYETIVYICDTPLKSNWTS
TCISQGDCILLLADAEDDVVATGIGDYERLLINLKTMARTDLCLLHPEKYVEPGSTSIWL
KNRIWVQGHHHIEMEIIRKKDENSVKKRPNIISELASKIGSKTNPSIKSTLEDVRLKAIS
SFVKLNTSFVHSDRYKAVQPHKNDFLRLARILSNEAVGLVLGGGGSRGISHVGIVTALER
HGIPVDLIGGTSIGSLVGGLYAKDYNIVSIYGRAKKFSKRVASLWRSVFDLTYPVTSYIT
GYEFNRGIWKIFGFTEIEDFWIRYFCNTTNITNSTMDIHESGYSWRFIRASMSLAGLLPP
IAFQGCMLLDGGYLDNLPVSEMKKKGAKYIIAVDVGSADDRTPMNYGDTLSGFWVLFNRW
NPFSKHPNVPNMMDIQMRLAYVASVNALEAAKKTNGVIYLRPPIDNYATLDFAKFDEIYH
VGLNYADKLFSSWSKNGKLPAIAGMVDKAKIKSGDDKKVLYRRNSI
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactccacagaagctcttaactctatagcgttcgctgtggatacgactttgtcg
ctgattctaccgtcttctttggctcctccatctgctccgccagcaacgtctctgttttta
aagtccatctggtacgcattctggtggttatggctgatggtagttttcaagatcatgaat
attatattgctttatattcccagcaagatcatgaatgcgctttcaatcaacttcgagatt
acattgaaccttctgtcgattcttgtcgcactcctggctatcattactgtctgttttctt
gtggtaagatacaaatatctcactggttattccaaagacacgagtgaccggaaaacaaaa
ggcaaagtcaacccatcagcatccaacatcaacttgaagaaccagagcctagactatgta
gaccagaagaagggccaccgtagaacgacaaactatttggacgagttcctctctgccatc
aaagtttttggctacttggaaaagtcggtcttccacgaattaaccaaaaatatgacaacc
caaaagttgtcacatgacgagatcctctaccttgatgaaaagcttggattctccatcgtt
gtagaaggagtaatgcaggtttatactagaatcaccgagaactccaatgtaagcggcggc
tttgatccggacgacgacaacgagctcaactacgaaaaggacgatgtgctaataatcgga
aatcaacgctaccagttactaaatgaagtcaaaagtggtgctcccttgagttctttggta
agtgttctagacttgttgaaaccggtagatagtgaagattcaacttcagatatgcttcat
tcatttaatatttctgacgatgacaacatctccaagattccagagatctcacccatctct
cttccatttcaaggaattcatgccggcgcgaaagatgattcagtgcctccttctcccatc
atcaggccttctaaaacgaagcagctctatccagaaatagttgccagacccaaaagtcgg
ccgcacaaagaacacaccggccatcatcttcatcatgttcaccattcaggtgccaccatt
gcaatcataccgtatctggcttttcagagggtacaatccaagtatccgaaagccacctct
cacatcgtcaccatggttctagccagattgtacaaggttacattcaacactattcacgac
tatttgggtctaaccaaagagatcatggagagtgaggtaaaattgaacactactagtagt
gtcaggggtgctaacttgccaggatacttatttgatggtcttcttgataagatatatggt
gccaacggaattaatgaagcaagcctttccagaaagtcagacttccaaagagcactgtct
gtaaatctcaacaaacagaagactactttatgcgacgctaagtcttcgaggtatgttctt
ctagattcccggttgaaatcgactcacccaggagacttgttgtcgtctgtgccattgtct
agaagatcagactattaccaaacacacagccatcctctttctgcagacgatcctttagtt
aggtctgcattcccaagttcaaagacattatcatcactttcatcaccaacttccaactta
aagagagccagttcaaacctaaaatttgagaatattcgtgacagatcattctctgacgac
cgtgaagaaacggaagaaacgtcgctcagaatagctgttgtcgagagcatcttcaaaatt
ttgggtattagcgagaagagcacagcgatgaggaatctttccagtttcaattcaggaagg
tcttctgtttcttcttcaattgtaggcttgtccaaccttatgagcgccgatgacaaattc
gataccaatgcagcacgggtaaggtttgattcgtataatggattctcttccacagccact
tcaatcagtagaagctccacacccatcaaattttacaataccattaaccaaaaccaattg
cacaaccatcacatgggtgactctgtcagtgggatcaacatctccacattaagtagacaa
catcaagcaaaccgaaactcttctccaacagagttcaactttgccaacgtcaagagtgac
ttcgccaaatgtttggaaatcaaatcatatggtccaaatacgactatcgtagaacaggga
tcgtttaattccggcttgtattatgtcattgatggctcattggatgtgttgtatcgtcca
agtaaccatggtgaacccagttcaaaccgtgaagacaatttgaaaaagctctattcagtg
aagagtggaggtgtagctggctatttatcctctgttgtaggctttagatcgctagtgaca
ataagaacttctaagaaaagaggagttatcgttgcacatatatccaagtcagactactcc
aagctaatggataggtactatttcttgcaattgccagttgctaccaagttgaagaagttg
ttatcaccacagattctaaccattgactacgccttagaatggtgtcatattcctgctgga
ggcgtcttgtgctcacagggggatttagccaatggatttcatatagtacttagtggcaga
ttcagagtggtcagaaacaagagtgacaggtatcaaggtaacacttcagatgatgatatt
cttggattttctgatacttctatggattgtagccccagtagtgacataaataacgaggac
cttgaggtgttgggtgaatatggccatggtgaatctattggagaagttgaggtattgaca
gcttctagaagaaccaactcattgattgcagttagggattcagagacagccagaattcct
agaactctttttgagatgctttcattgctgaatccttccattatggtgaaggtttccaga
attgtagccagtaaagttgtttataaggatgtgcttgaccagtcgtctcgcaattctaca
ctcattccatcttccacagcctctcatatctccaatgactacaaaacaattacaatattg
cctacagtaagtggcctaccagtcagagagtttgctgataagttggtttctgcattgaaa
gcgattggcaggaatgtcattgctttggatcaggcttctacattgacccacctaggcaga
catgcctttgatgagcgtttggcacagttgaaattgtctggttactttgcctatttagaa
gaagagtatgaaaccatcgtctatatctgtgatacgcccttgaagtcaaactggacttcc
acgtgtatttctcagggagattgtatcttgttacttgccgatgcagaggacgatgtagta
gccactggtattggggactacgagcgcttgttaattaacttgaaaacgatggctaggacg
gatttgtgcttgcttcacccagagaaatacgttgagcctggctccacaagtatctggttg
aagaatcgaatttgggtccaaggtcaccatcatattgaaatggaaatcatccgtaaaaaa
gacgaaaattctgtgaaaaagagaccaaatattatcagtgaattggcgtctaagataggg
agcaagacgaatcccagtattaagtctactcttgaagatgtgagacttaaagcaatttct
tcctttgtgaagttgaacactagttttgtacattctgatagatataaggctgtgcaacca
cataaaaacgattttcttcgtttggctagaattctctccaatgaagctgttggattggtt
cttggtggcggtggatctcgtggaatatcccatgttggtatagtgaccgcattagaaaga
catggcatccctgtggatttgataggcggaacttctataggttcccttgtaggtgggctc
tatgccaaagactacaacatagtgtcaatctatggtagagcaaaaaagttttctaaaaga
gttgcttcgttgtggaggtctgtattcgatttaacatatccagtaacgtcatacatcact
gggtacgagttcaacagaggaatttggaaaatctttgggtttacggaaattgaagatttc
tggatcagatatttttgtaacactaccaacatcaccaactctacaatggatatccatgaa
agtggttatctgtggagattcattagagcatcgatgtcgttagcgggtcttttacctcca
attgcctttcaaggttgcatgctattggatggcggttacttggataacttgcctgtcagt
gagatgaagaagaaaggtgccaaatacatcattgcggttgatgtaggctctgctgatgac
agaacacccatgaattatggtgatacattgtctggattctgggtgttattcaatcgttgg
aacccattttctaagcatcctaatgttcccaacatgatggatattcaaatgagattggcc
tatgtagcaagtgtcaacgcattagaggctgcgaaaaagaccaatggggtgatttacttg
agacctcctattgataactacgccacgttggattttgccaaattcgacgagatttaccat
gtcggcttaaattacgcagacaaactcttttctagctggtctaagaatggcaaacttcca
gcaatagcaggcatggtggataaggcgaagatcaaaagtggagatgacaagaaagtgtta
tacagacggaactctatctga

DBGET integrated database retrieval system