KEGG   Scheffersomyces stipitis: PICST_33726Help
Entry
PICST_33726       CDS       T01023                                 

Gene name
SGA1
Definition
Glucoamylase GLU1 precursor (Glucan 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase) (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pic00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 560 aa AA seqDB search
MKLQLLLLLQFVSFCYSLYIPIGGQSFNRGLIEIEKSIGDATDGSFLPGFIQQFFSWSVS
EKVEDNIRLVDFETWIEKQKEISFRGILNNIGGVSDTLEQSEVSKGAVIASPSRIQPNYF
YQWVRDAALTIKSLVYHIDDNNFENVDDIQSVIEAYIENNYYLQRLDNNSGKFDDPDKSG
LGEPKFHANNTAFVQNWGRPQRDGPGLRAITILSYVSLLDKWNKKVSNKFLKSPEFIYNK
IVKPDLTYIVRNWFKEGFDLWEEINSHHFYTSVTQLAAIKDGLLLAQKFEKDSDFLRQLQ
ITYTNLKQFIENDSGYKNPAVPYIVETPSLLRAGKRTGLDAGSLLGSLHSHNMEFGDYSD
IPFDVNDTHLINTLSAMVADMKYRYPLNHNKIGFEKGIGCALGRYPEDIYDGYGTSEGNP
WFISTASASELIYKFIYNLEHNHMDIVINSQNKDFFKQFVDFDNIPSNDLTTVPANDYTD
SIVIRYGTQTFRTLSINLVTYSDSFLEVIKDHVDNQGRMSEQFNKYHGFMQGARDLTWSY
SAVWNAFRWRQKTLDILDQF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcaattactattgttattacagtttgttagcttctgctacagtttgtacatc
ccaattggaggacaatctttcaatagaggtctcatcgaaattgaaaaaagcataggtgat
gctaccgacggctcattccttcctggttttattcagcagttcttcagttggtcagtttcg
gagaaggtagaagataacatccgccttgttgattttgagacatggattgagaagcagaag
gaaatttcattcagaggtatccttaataatatcgggggtgtcagtgatactctcgaacaa
tctgaagtttccaaaggcgctgtaatcgcttctccatcgagaattcagccaaattacttt
taccagtgggtgagagacgctgctttaaccattaagtcacttgtttatcacattgatgat
aacaattttgaaaatgtcgacgatatccaatcagttatcgaagcgtacatagagaacaac
tattatttgcaacgtttagataacaactctggaaagtttgatgacccagataagtctggc
cttggagaaccaaagttccatgcaaacaatacggctttcgtccaaaactggggtagacct
cagagagatgggccaggtttaagagctatcactattttgagttatgtgagcttgttggac
aagtggaacaagaaagtttccaacaagtttttgaagtctccagaatttatctataacaaa
atcgtgaagcctgacttaacttacattgtcagaaattggttcaaagagggatttgattta
tgggaagaaataaattcgcatcacttttacacgtctgtcacacaactagctgcaatcaag
gatggtttattattggcccagaagtttgaaaaagattccgattttttgagacaattgcaa
atcacttatacaaacttgaagcaatttatagagaatgattctggttacaagaaccctgct
gtaccgtatatcgttgaaactccactgttacttagagcaggtaaacgtactggcttggat
gctggatcactcttgggttctcttcattctcataacatggaatttggagactatagtgac
attccgtttgatgttaatgatacccatttgatcaacactttgagtgcaatggtcgcagat
atgaagtacagatatcctctcaatcataacaagattgggtttgaaaagggcattggatgt
gccttgggaagatatcctgaagatatttatgatggatatggtacttctgaaggtaaccca
tggtttatttcaactgcttctgcttctgaactaatttacaagtttatatacaacttagag
cataaccacatggatattgtgattaacagtcagaacaaagatttcttcaaacagtttgtt
gactttgataatatcccatcaaatgacttgacaacagtacctgccaatgattatactgat
tcaattgtgattagatatggaacccaaacattcagaacactctcaattaatttggtgaca
tattctgattcctttttggaagtgatcaaagatcacgttgataatcagggccgcatgtcg
gagcaattcaataagtatcatggtttcatgcaaggtgcaagggatttgacttggagttat
agtgcagtttggaatgccttcagatggagacagaagactttagatattttagaccaattc
tag

DBGET integrated database retrieval system