KEGG   Scheffersomyces stipitis: PICST_33726Help
Entry
PICST_33726       CDS       T01023                                 

Gene name
SGA1
Definition
Glucoamylase GLU1 precursor (Glucan 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase) (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PICST_33726 (SGA1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PICST_33726 (SGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 560 aa AA seqDB search
MKLQLLLLLQFVSFCYSLYIPIGGQSFNRGLIEIEKSIGDATDGSFLPGFIQQFFSWSVS
EKVEDNIRLVDFETWIEKQKEISFRGILNNIGGVSDTLEQSEVSKGAVIASPSRIQPNYF
YQWVRDAALTIKSLVYHIDDNNFENVDDIQSVIEAYIENNYYLQRLDNNSGKFDDPDKSG
LGEPKFHANNTAFVQNWGRPQRDGPGLRAITILSYVSLLDKWNKKVSNKFLKSPEFIYNK
IVKPDLTYIVRNWFKEGFDLWEEINSHHFYTSVTQLAAIKDGLLLAQKFEKDSDFLRQLQ
ITYTNLKQFIENDSGYKNPAVPYIVETPSLLRAGKRTGLDAGSLLGSLHSHNMEFGDYSD
IPFDVNDTHLINTLSAMVADMKYRYPLNHNKIGFEKGIGCALGRYPEDIYDGYGTSEGNP
WFISTASASELIYKFIYNLEHNHMDIVINSQNKDFFKQFVDFDNIPSNDLTTVPANDYTD
SIVIRYGTQTFRTLSINLVTYSDSFLEVIKDHVDNQGRMSEQFNKYHGFMQGARDLTWSY
SAVWNAFRWRQKTLDILDQF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcaattactattgttattacagtttgttagcttctgctacagtttgtacatc
ccaattggaggacaatctttcaatagaggtctcatcgaaattgaaaaaagcataggtgat
gctaccgacggctcattccttcctggttttattcagcagttcttcagttggtcagtttcg
gagaaggtagaagataacatccgccttgttgattttgagacatggattgagaagcagaag
gaaatttcattcagaggtatccttaataatatcgggggtgtcagtgatactctcgaacaa
tctgaagtttccaaaggcgctgtaatcgcttctccatcgagaattcagccaaattacttt
taccagtgggtgagagacgctgctttaaccattaagtcacttgtttatcacattgatgat
aacaattttgaaaatgtcgacgatatccaatcagttatcgaagcgtacatagagaacaac
tattatttgcaacgtttagataacaactctggaaagtttgatgacccagataagtctggc
cttggagaaccaaagttccatgcaaacaatacggctttcgtccaaaactggggtagacct
cagagagatgggccaggtttaagagctatcactattttgagttatgtgagcttgttggac
aagtggaacaagaaagtttccaacaagtttttgaagtctccagaatttatctataacaaa
atcgtgaagcctgacttaacttacattgtcagaaattggttcaaagagggatttgattta
tgggaagaaataaattcgcatcacttttacacgtctgtcacacaactagctgcaatcaag
gatggtttattattggcccagaagtttgaaaaagattccgattttttgagacaattgcaa
atcacttatacaaacttgaagcaatttatagagaatgattctggttacaagaaccctgct
gtaccgtatatcgttgaaactccactgttacttagagcaggtaaacgtactggcttggat
gctggatcactcttgggttctcttcattctcataacatggaatttggagactatagtgac
attccgtttgatgttaatgatacccatttgatcaacactttgagtgcaatggtcgcagat
atgaagtacagatatcctctcaatcataacaagattgggtttgaaaagggcattggatgt
gccttgggaagatatcctgaagatatttatgatggatatggtacttctgaaggtaaccca
tggtttatttcaactgcttctgcttctgaactaatttacaagtttatatacaacttagag
cataaccacatggatattgtgattaacagtcagaacaaagatttcttcaaacagtttgtt
gactttgataatatcccatcaaatgacttgacaacagtacctgccaatgattatactgat
tcaattgtgattagatatggaacccaaacattcagaacactctcaattaatttggtgaca
tattctgattcctttttggaagtgatcaaagatcacgttgataatcagggccgcatgtcg
gagcaattcaataagtatcatggtttcatgcaaggtgcaagggatttgacttggagttat
agtgcagtttggaatgccttcagatggagacagaagactttagatattttagaccaattc
tag

DBGET integrated database retrieval system