KEGG   Scheffersomyces stipitis: PICST_33851Help
Entry
PICST_33851       CDS       T01023                                 

Gene name
STE7
Definition
Serine/threonine-protein kinase STE7 homolog
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pic  Scheffersomyces stipitis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pic04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 523 aa AA seqDB search
MMHLSNNSSSSLCSTKDKKLPPIPSTPIESTHFSTGSPLAGSPRIADTDSGILQSKTLKR
KNFKKLSLNASPEAKFTDTDHSSLKFEGSSLRQNRINVRPAPLLNLKQKDSQPSHSDQID
VKQTNTKFDPDQQSSTNLIINQISNLELSTASLNQHVTPLNRKRQTVISSISPTKSSASS
PLEPNNRVNNLVDNSMILQNNTMSPIATTSSFTLNNDDLVTLKNLGSGNSGTVCKILHVP
TQKTMAKKTIHIDLKTVIQTQIIRELRILHECQSPYIIEFYGAFLNTNNTIVICMEYCNC
GSLDKILPLCDDKQFPLYVLKKLAYSILSGLSYLYTTHKIIHRDIKPSNVLMTHKGEFKL
CDFGVSRELTNSLAMADTFVGTSTYMSPERIQGLNYGVKSDVWSMGLMLIELANGVPVWS
DDEAGQTGGPEGILDLLQRIVNETPPTLTGKINNITKQKFDPLLCQFIDSSLIKDDSLRK
SPRELLDDKDGFLKGVEEGVFEKDVKSWAKKIRKLHKEKTEDK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacctcagcaacaactcgctgtcatccctatgctccaccaaggataagaagtta
ccgcctataccgtcaactcctattgagagtacgcatttctccactggttctcctcttgca
ggatctcctcgcatagccgatactgactctggcattcttcagtccaagacattgaagaga
aagaacttcaagaagttgtcgttgaacgcttctccagaagcaaaattcacagacactgac
cattcctccttgaaatttgaaggctcttctctaagacagaatcgcatcaatgtgagacct
gctccactccttaatttgaaacagaaggacagccagcccctgcattccgatcagatcgac
gtcaaacaaacaaacacaaagttcgatcccgaccagcagtcgtctacgaacttgatcata
aatcagatctcaaatttggagctttccactgcatctttaaaccaacatgtaactcctttg
aaccgaaaacggcaaacagtcatatcttccatttctcctactaagtcttcagcatcgtct
cccttggagcccaacaacagggtcaacaatttggtggataactctatgatcctacaaaat
aataccatgtctcccatagccacgacctcatcatttactttgaacaacgacgatttggta
actctcaagaatttgggctcaggcaattcaggaacggtctgcaagattttgcatgtacca
actcagaaaaccatggctaagaaaacgattcatatcgatctaaaaacggtgatacagact
cagattattcgcgaattacggatcttgcacgaatgccagtctccgtacatcattgagttc
tacggtgctttcctcaacactaacaacaccatcgtgatctgcatggagtattgtaattgt
ggttctctagacaagatactccctctctgcgatgacaaacagttcccactttatgtgctt
aagaagcttgcgtactcgattctcagtggcttgtcgtatctttacactactcacaaaatc
attcacagagatatcaaacctagcaatgtgcttatgacccataaaggagagttcaaactt
tgtgactttggtgtctccagagaattgacaaactccttggccatggcagacacctttgta
ggaacatctacgtacatgtcgcccgaaagaatacaaggtctaaactatggtgtcaagtct
gatgtctggtcgatggggttgatgttgatagaattagctaacggtgtaccagtatggtca
gacgatgaagctggtcagacaggtggccctgaaggtattttagacttgcttcaacgaatt
gttaacgagactccaccaacattgacaggaaagattaacaacattacaaaacagaagttc
gatcccttgttgtgccagtttattgactcgtccttgattaaagacgatagtcttcgtaag
tctccacgtgagctcttggatgacaaagatggattcctcaaaggtgtagaagaaggtgtg
tttgaaaaagacgtaaagtcatgggccaagaagatcagaaaactccataaggaaaagaca
gaagacaaatag

DBGET integrated database retrieval system