KEGG   Scheffersomyces stipitis: PICST_33873Help
Entry
PICST_33873       CDS       T01023                                 

Gene name
MSP1
Definition
(RefSeq) 40 kDa putative membrane-spanning ATPase
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_33873 (MSP1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     PICST_33873 (MSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_16 RuvB_N AAA_14 AAA_2 AAA_5 AAA_22 AAA_33 IstB_IS21 Mg_chelatase RNA_helicase Parvo_NS1 TniB AAA_18 NACHT AAA_24 TIP49 Sigma54_activ_2 ATPase_2 DUF815 AAA_25 ABC_tran Sigma54_activat Bac_DnaA NB-ARC AAA_17 Viral_helicase1 Zeta_toxin AAA_28 TsaE
Motif
Other DBs
NCBI-GeneID: 4841135
NCBI-ProteinID: XP_001386533
JGI: 33873
UniProt: A3M0D7
Position
8
AA seq 357 aa AA seqDB search
MAKFKLDIKFLGDLFILAGAGLSVYFILNNILNDYVDNSMKNKESEKKGKGILKKLQSSN
PHLRNISLNQYEKSLLNSLVTPEEISVTFNDVGGLQDIIDELREAVILPLTEPELFATHS
DLIQSPKGVLFYGPPGCGKTMLAKAIAKESGAFFLSIRMSTIMDKWYGESNKITDAIFSL
ANKLQPCIIFIDEIDSFLRDRSSSDHEVSAMLKAEFMTLWDGLKSNGRIMVMGATNRKSD
IDEAFLRRLPKTFAIGKPNESQRRSILSKILSGAKLDEKDFDLEYIVANTKGFSGSDLRE
LCREAAILPVREYIRENYNYRSGKLSKDENEDMPVRPLKTSDFVKTAESTIQPATID
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttcaaactcgatataaagtttcttggagacttgtttattcttgcgggagct
gggctctcagtatatttcatactcaacaatatactcaacgactatgtagacaactctatg
aagaacaaggaatcggagaaaaagggcaagggcattctcaagaaattacagagttctaat
ccgcacctccgcaacatctccctcaaccagtacgagaagctgttgctcaattcgttggtt
acaccagaagaaatatcagtaactttcaatgatgtgggcggtttgcaagacataattgac
gagttgagggaagcggtgattcttcctttaacagaaccagagcttttcgctacccatctg
gatttgatccagtcacctaagggtgtcttattctacggtccccctggatgtggtaagaca
atgttggccaaagctattgccaaagaaagtggtgcgtttttcttgctgataaggatgtcg
actattatggacaaatggtacggtgagtcgaacaagatcaccgatgccatcttctcactt
gctaacaaattgcaaccctgtattattttcattgacgaaatagattcgtttttgagagac
aggtcttccagcgaccacgaagtcagtgccatgttaaaggctgaattcatgacgttgtgg
gacggcttgaagtctaacggaagaatcatggtaatgggcgctaccaatcgtaagagtgac
attgacgaagccttcttgagaagattacccaaaacttttgctattggcaaaccaaacgaa
tcgcaaagacgttccatattgtctaaaatactaagtggagccaagctcgatgaaaaagat
tttgacttggaatacatcgttgctaatacaaaaggctttagtggttctgacttgagagaa
ttatgtcgtgaagctgccattcttcccgtcagggagtacatcagagagaattacaactat
aggagtgggaagttgagcaaggatgaaaatgaagacatgcctgttagaccgttgaagact
tctgattttgtaaagactgccgagtccaccattcaacctgctaccattgattag

DBGET integrated database retrieval system