KEGG   Scheffersomyces stipitis: PICST_34686Help
Entry
PICST_34686       CDS       T01023                                 

Gene name
KNS1
Definition
serine/threonine protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PICST_34686 (KNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 570 aa AA seqDB search
MSLISNRKRPRGFSETVLIEENEDDVVDEDPEVIDDEDDEDLIILEERDLIPKPRRNNSD
SLLILDSDAVEAYNMFNVNNINNNINQPFEIGANNNPIKKQRTNSLPQLPQARCFYTKLP
NNYIFQTPKLGNIKTNVIPHQLNLPPCDDENGHYVIKLNETFANRFIIIKLLGQGTFGKV
VQCFDKVNREHVAIKIIRNIQKYRDAAKIELRILSTLKKFDNKNVNHCIHLRECFDYRGH
ICIVTDLLKISLYDFLENNKFISFPGSHIQAISKQLIRSVSFLHDLNLIHTDLKPENILL
HDDSHIKKNLYSSTIVSSYMNLSSSSAPKKTPKYSKVLKNPLIQIIDFGSAIFNDEYHSS
IVSTRHYRAPEIVLGVGWSFPCDMWSIGCILVELIIGEPLFKTHDNLEHLAMIEKICGYR
IDKAMVKLSKEKENECGLEYFTKEYISSEEDSDGDDDVIIDDETTKYNSLTLMFPTNSTP
MKFINSVDELSRIDLFVSSRIGLDIDFDYSLSANYEKNKNIINFGNFTFWWFFIDLLRKL
FVINPEDRLNAMDALYHPWFNLGIEDEGTL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatatccaatagaaagagacccagggggttcagtgaaacggtgttgatagag
gagaacgaagacgacgtcgtagatgaagatccggaagtaattgacgatgaagacgacgaa
gacttgatcatactcgaggaacgggacttgattccaaaaccgcgcaggaacaactctgac
tccttgctcattctagacagcgatgccgtagaggcatacaacatgttcaatgtgaacaac
atcaacaacaacatcaaccaaccgtttgagatcggcgcaaacaacaaccctataaagaaa
cagagaaccaactcactaccgcagttaccgcaggctcgctgtttctacaccaagttgcca
aataactacatctttcaaacgccgaagttgggcaacatcaagacgaacgtaataccccac
cagctcaacttacctccttgtgacgatgaaaacggccattatgtcatcaagttgaacgag
acctttgccaatcgcttcatcatcatcaaacttcttggccaaggtacatttggcaaagtc
gtgcaatgttttgacaaagtaaatcgtgagcatgtagccatcaagataattcgtaatatc
cagaagtatcgcgacgctgctaagatcgagttgcgcatcttgtcgactctaaagaagttc
gacaacaagaacgtcaaccattgcattcatctccgggaatgctttgactatagaggccat
atctgtatagttacggacttgttgaagatttcgctttacgacttcttggagaacaacaag
ttcatatcgttccccgggtctcacatccaagccatttctaaacagttgatacgttctgtg
agctttttgcacgacttgaacttgattcacacagacttgaagccagaaaacatcttgctc
cacgacgactctcacatcaagaagaacctatacagctctactatcgtatcgagttatatg
aacttatcgtcttcctctgcacctaagaagactcccaagtatctgaaggtgttaaaaaat
ccattgatacagatcattgattttggttctgccatctttaacgacgagtaccactcctct
attgtctctacgaggcactacagagctccagaaattgttttgggcgtaggctggtcgttt
ccgtgcgatatgtggtctattgggtgcatactcgtagagttgatcattggtgagcctctc
ttcaagacccacgacaacttggagcacttggcgatgattgagaagatctgtggctacaga
atagataaggccatggtcaagttgtccaaggagaaggaaaacgagtgcggactcgaatat
tttaccaaggaatatatcagctctgaagaagactcggatggtgacgacgacgtgattata
gacgacgaaactaccaagtacaactcattgacgttgatgtttcctacgaactcgactcct
atgaagttcatcaacagcgtagacgagttgtcgcggatcgacttgtttgttagttctcgt
atcggcttggatatcgactttgactattcgttatcggccaactacgagaaaaataagaac
atcatcaacttcggcaacttcacgttctggtggttcttcatcgaccttttgcgcaagttg
ttcgtcataaacccggaagaccgtctcaatgccatggatgcattgtaccatccgtggttc
aacttgggcattgaggatgagggtacattgtaa

DBGET integrated database retrieval system