KEGG   Scheffersomyces stipitis: PICST_34960Help
Entry
PICST_34960       CDS       T01023                                 

Gene name
GHC1
Definition
GTP cyclohydrolase I (GTP-CH-I)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pic  Scheffersomyces stipitis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PICST_34960 (GHC1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PICST_34960 (GHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 270 aa AA seqDB search
MSDTPAKSSASSEHEELNGTYSPRPILPIKRSKLTGSSEFHVGTPLQTRVASPCTLNPPI
DSDGLSWPSQGARKRIEQTPEEAEAREARIADAVKVILHELGEDVDREGLLETPERYARA
MLFFTKGYEDNIRDVIKRAVFEENHDEMVIVRDIEIYSLCEHHLVPFFGKAHIAYIPNKR
VLGLSKLARLAEMYARRFQVQERLTKQIAMALSEILRPRGVAVVIEATHMCMVSRGVQKT
GSSTTTSCMLGCFRDHQKTREEFLTLLGRK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatactccagctaaaagctcagcctctagcgagcacgaagaactcaacggaacc
tattctcctagacccattttgcccatcaagagatcaaagctcactggaagttctgaattc
catgtgggtacgcctcttcagactcgtgtagcttctccatgtacattgaatccccccatt
gacagtgacggtttgtcgtggccatcacagggagcaagaaagagaatcgagcagacacca
gaagaggcggaagcacgagaagctcgtatagcagatgccgtgaaagtcattttgcacgag
ttgggtgaagatgtagacagagaaggtttgcttgagaccccggaacggtatgccagagca
atgttattcttcaccaagggctatgaagataacattagagatgttatcaagagagctgtt
tttgaagagaaccacgacgagatggtgatagtgagagacattgagatttattcgttgtgt
gagcaccacttggttccgtttttcggcaaagcccatattgcttatattcccaacaaaaga
gtcttgggcctttccaagttggcccgtttggctgagatgtatgcccgtagattccaggtc
caggaacgtttgacgaaacaaattgccatggcactctctgagatcttgagacctcgtggt
gtagctgtagtaattgaagctactcacatgtgtatggtcagtcgaggagttcagaagaca
ggctcttcaaccactaccagttgtatgttgggctgtttccgcgaccaccaaaagaccagg
gaagagttcttaacgttgttgggaagaaagtag

DBGET integrated database retrieval system