KEGG   Scheffersomyces stipitis: PICST_34960Help
Entry
PICST_34960       CDS       T01023                                 

Gene name
GHC1
Definition
GTP cyclohydrolase I (GTP-CH-I)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pic  Scheffersomyces stipitis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pic00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 270 aa AA seqDB search
MSDTPAKSSASSEHEELNGTYSPRPILPIKRSKLTGSSEFHVGTPLQTRVASPCTLNPPI
DSDGLSWPSQGARKRIEQTPEEAEAREARIADAVKVILHELGEDVDREGLLETPERYARA
MLFFTKGYEDNIRDVIKRAVFEENHDEMVIVRDIEIYSLCEHHLVPFFGKAHIAYIPNKR
VLGLSKLARLAEMYARRFQVQERLTKQIAMALSEILRPRGVAVVIEATHMCMVSRGVQKT
GSSTTTSCMLGCFRDHQKTREEFLTLLGRK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatactccagctaaaagctcagcctctagcgagcacgaagaactcaacggaacc
tattctcctagacccattttgcccatcaagagatcaaagctcactggaagttctgaattc
catgtgggtacgcctcttcagactcgtgtagcttctccatgtacattgaatccccccatt
gacagtgacggtttgtcgtggccatcacagggagcaagaaagagaatcgagcagacacca
gaagaggcggaagcacgagaagctcgtatagcagatgccgtgaaagtcattttgcacgag
ttgggtgaagatgtagacagagaaggtttgcttgagaccccggaacggtatgccagagca
atgttattcttcaccaagggctatgaagataacattagagatgttatcaagagagctgtt
tttgaagagaaccacgacgagatggtgatagtgagagacattgagatttattcgttgtgt
gagcaccacttggttccgtttttcggcaaagcccatattgcttatattcccaacaaaaga
gtcttgggcctttccaagttggcccgtttggctgagatgtatgcccgtagattccaggtc
caggaacgtttgacgaaacaaattgccatggcactctctgagatcttgagacctcgtggt
gtagctgtagtaattgaagctactcacatgtgtatggtcagtcgaggagttcagaagaca
ggctcttcaaccactaccagttgtatgttgggctgtttccgcgaccaccaaaagaccagg
gaagagttcttaacgttgttgggaagaaagtag

DBGET integrated database retrieval system