KEGG   Scheffersomyces stipitis: PICST_35297Help
Entry
PICST_35297       CDS       T01023                                 

Gene name
PFY1
Definition
profilin (actin-binding protein)
Orthology
K05759  
profilin
Organism
pic  Scheffersomyces stipitis
Brite
Exosome [BR:pic04147]
 Exosomal proteins
  Proteins found in most exosomes
   PICST_35297 (PFY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 126 aa AA seqDB search
MSWQAYTDNLVATGKIDKAALYSKAGDSLWAQSSGFQLQANEISEIAKGFDDPSGLQSHG
LHVLNQKYFLLRADERSIYGKHEAEGVVAVRSKQAILIAHYPSGVQAGEATTVVEKLADY
LISVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcatacactgacaacttggttgccactggcaagatcgacaaggctgcc
ttatactccaaagctggagactcgttgtgggctcaatcgtctggattccaattgcaagcc
aacgaaatctcagagatcgccaagggtttcgacgacccctcgggattacaatcccacggc
ttgcacgtcctcaaccagaagtactttttgttgagagctgacgaaagatccatctatggt
aagcacgaagccgagggtgtcgttgctgtcagatccaagcaggccatcttaattgctcac
tatccatcgggagttcaagccggagaagccaccactgtcgtggagaagcttgctgactac
ttgatcagtgttggttattag

DBGET integrated database retrieval system