KEGG   Scheffersomyces stipitis: PICST_35732Help
Entry
PICST_35732       CDS       T01023                                 

Gene name
XYN1
Definition
Glycoside hydrolase, family 10 Endo-1,4-beta-xylanase precursor (Xylanase) Exoglucanase/xylanase precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 321 aa AA seqDB search
MYFGTATNQEQWSNKEYTELMLEQFGSMTPANVQKWMYTEPEQGVFNYTAGDEFANYALK
NKKVLLCDTLVWHQQYPSWLDEKTWTKKDLLNVIYQHVYNEVKHFKGRCFSWNVVNEALN
EDGTWRQSLFYNVTGTDYIETAFLAASAADPRAQLYYNDYNIEYPGPKSAAVENMVKWLR
SKHVKIDAVGLESHFIVGQAATEAQQQQQMQSYIDLGVQVVVSELDVRFETLPPTEAGLA
QQTVDYQASINACIKVGKQCMGISVWDFDDEYSWIPSSFAGQGDADLWYANFTTTPAYTG
VVSALEAGIEKGYKSKEKLRL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtactttggcactgctaccaaccaggagcaatggtctaacaaagaatacactgagtta
atgctcgaacaattcggttctatgactcctgcaaatgttcaaaagtggatgtacactgaa
ccggaacaaggcgtctttaattacactgctggtgatgaattcgctaactacgcattgaag
aacaagaaagttcttttgtgtgatactcttgtttggcatcaacagtatccttcttggtta
gatgaaaagacatggaccaagaaggatttgcttaatgtaatttatcaacacgtctataat
gaagtgaaacacttcaagggtagatgtttttcttggaatgttgtcaacgaagctttgaac
gaagatggaacttggagacaatcactcttctacaacgttactggtactgattacattgaa
actgctttccttgctgcttctgccgccgatccaagagctcaactttactacaatgattac
aatatcgaatatccaggtccaaagtcagctgcagtagagaatatggtcaaatggcttagg
agcaagcacgtgaaaatcgatgctgttggtcttgaatctcatttcattgttggacaggca
gcaactgaagctcagcagcagcagcagatgcaatcatacattgatttgggtgttcaagtt
gttgtttcggaactcgatgttagatttgaaactctaccacctactgaagctggtcttgct
caacaaactgttgactaccaagcctctattaacgcttgtattaaggtaggaaagcaatgt
atgggtatctcggtttgggactttgatgatgagtactcgtggattccaagttcctttgct
ggtcaaggtgatgctgatttgtggtacgcaaactttactacaactccagcttacactgga
gttgtttctgcccttgaagcaggaattgagaagggttacaaaagcaaggaaaagttaaga
ttgtaa

DBGET integrated database retrieval system