KEGG   Scheffersomyces stipitis: PICST_36800Help
Entry
PICST_36800       CDS       T01023                                 

Gene name
COM1
Definition
catechol o- methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pic  Scheffersomyces stipitis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PICST_36800 (COM1)
Enzymes [BR:pic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PICST_36800 (COM1)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PICST_36800 (COM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 254 aa AA seqDB search
MPEKEQKVLQHILSLPEDRLKQIRGKPQEVLKLIDDFSENVESLMNIGPYKGKLIVDKIK
EKKPKIMVELGGYVGYSAILFGSSLPDDPSSHYYSLELNEEFANISRQLIDLAGLSHRVS
IIVGKASSSLVEMVDHFEEGNKGYFSFDFIFIDHWKDMYVPDLRVLESLTLISPGTIIVA
DNIYYPGAPDYVKYIQGSPEERRDHNYTVTNVAAPEFQGRWNILYKSETIPVKNPKSGTE
DAIEVTECVEYLNG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaggaacagaaggtgctccagcacatcttatctttgccagaggataggctc
aagcaaatccgcggtaaacctcaggaagtacttaagctcattgatgactttagcgaaaat
gttgagtcattgatgaatatcggcccctacaagggcaaacttattgttgacaaaatcaag
gagaagaagcccaagatcatggtagaattgggaggctatgttggatactcggctattttg
tttggtagtagtttaccagacgatccttcgctgcactactatagtttggaactcaacgag
gagtttgccaatatctcccgtcagcttatagatctagctgggttgctgcatagagtgtcg
atcattgtaggtaaggcgtcgagctcacttgtagaaatggtagatcattttgaagagggc
aataaaggctacttttcgtttgacttcatcttcatcgaccattggaaggatatgtatgtt
cctgatctccgtgtgcttgagtcgcttacattgatatcaccaggtaccattattgtagcc
gacaatatctactacccgggagctcctgattatgttaagtatatccagggcctgccagag
gagagaagggaccataattacacagttaccaacgttgcagctccagaattccagggcagg
tggaatatactttacaaatccgagacgattccagtcaagaatcccaaatcgggaaccgaa
gatgccattgaggtaaccgaatgcgtggaatacctcaatggttag

DBGET integrated database retrieval system