KEGG   Scheffersomyces stipitis: PICST_37619Help
Entry
PICST_37619       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pic  Scheffersomyces stipitis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PICST_37619
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PICST_37619
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PICST_37619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 178 aa AA seqDB search
MVEVYYHDNNDTPDNFTDAHNSGVPVPLEDLATIGVFYKNITNLDDLNKLATERQYRNRD
EVNLNLAAFNNDLDAYNRKMQQFYKEHYHEDEEIRYIVDGEGYFDVRDKSDRWIRTKLVA
NDLLILPAGIYHRFTLTNDLKYVKAVRLFKDEPKWEAINRDAGKLSEAREEYVKSIAV
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagtatactaccacgacaacaacgacaccccagacaacttcactgatgctcac
aactctggtgtacctgttcctttagaggatttggctacgattggggttttctacaagaac
atcaccaacttggacgacttgaacaaacttgctactgaaagacagtacagaaacagagac
gaggtcaacttgaacttggctgctttcaacaatgacttggatgcttacaacagaaaaatg
cagcagttctacaaggaacactaccacgaagatgaagaaatcagatacattgtagatgga
gaaggctacttcgatgtcagagacaagagcgacagatggatcagaaccaagttggtagcc
aacgatttgttgatattgcctgcagggatttaccaccgttttaccttgaccaatgacttg
aagtacgtcaaggctgtaagattgtttaaagatgaacccaagtgggaagctatcaacaga
gatgctggtaagttgagtgaagctcgtgaagagtatgtcaagagcattgctgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system