KEGG   Scheffersomyces stipitis: PICST_37903Help
Entry
PICST_37903       CDS       T01023                                 

Gene name
UBP6
Definition
deubiquitinating enzyme (EC:2.4.2.29)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PICST_37903 (UBP6)
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PICST_37903 (UBP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 481 aa AA seqDB search
VSIKNAGKVYDIELEADATGIDFKQKIQELTSIPPNRQKILVKGGKVNDTDNVSAIVASA
KQPIMVLGTPDKNLPSKPIEKQVFLEDLNSNQLTNVSNDPSGLVNLGNTCYLNSSLQTLF
KIEDVNKKVSSYQAGRSSGVSPTNALVVGLKSLVGQMSKKQEKVNPTLFLALFRNQFPQF
AERDNHGFYKQQDAEEAFSQILRVLCDELKIEDSFRLTFNTDTKCLALPEEEHVFGVEES
LKLNCHIDIKTNFLRDGLLAGLKDTMEKYNDTLQSNAEYEVSKKITRLPKYLTVHFVRFF
WRRDTQKKSKILRRVQFPFELDLSEMLDDSIKSDKVSIRDQLRKIEKDNLDLIRDFKKAK
KDTTLNPLEQQEEDEMKLLSIKSKFSDSFKSILPEGFNVEETSENPSSVYELSAVITHAG
SSADSGHYQSFIKDDSDLDGERWWKFNDDKVSSVNKEKIESLAGGGESDSALILIYKGLG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtttctatcaaaaacgctggaaaggtctacgacattgagcttgaagctgatgccacgggt
atagatttcaagcaaaagatccaggaattgaccagtattccacctaatagacagaaaatc
ttagtaaaaggtggaaaggtcaatgatactgacaatgtttctgcaattgtagccagtgcc
aaacaacctatcatggtgttgggaactcccgacaagaatcttccctcaaagcccatagag
aaacaagtttttttggaggatttgaatctgaaccagttgacaaatgtgtcgaatgaccct
tcaggattggtgaatttggggaacacgtgttatttaaactcttcgctccagaccttgttt
aaaattgaagatgtcaacaagaaggttagtctgtatcaggctggtagatcttctggtgta
agtccaaccaatgccttggtcgtgggtttgaaaagtttagtaggtcagatgagcaagaaa
caggagaaagttaatcctactttgtttctcgctctttttagaaaccaattccctcaattc
gctgaaagagacaaccatggcttttacaagcagcaggatgccgaagaagccttttcacag
atcttgcgggttttatgtgacgaattgaaaatagaggactcgttcagactcacgttcaat
accgataccaagtgtcttgccttgcctgaagaagagcatgtttttggcgttgaggagtca
ctcaaattgaactgccatatcgacatcaagaccaactttctccgagatggcttattggcc
ggattgaaagataccatggaaaaatacaatgatacattacagagcaatgccgagtacgaa
gtctcgaaaaagatcaccagattgccaaagtacttaactgttcactttgtcagatttttc
tggagaagagacacccagaagaagtccaaaattctcagaagagttcaatttccatttgag
ttggacttgtcagaaatgttggatgattctataaagtctgacaaggtcagtatcagggac
cagttaagaaaaatcgaaaaggacaacttagatttgatccgggactttaagaaagctaaa
aaagataccacattgaacccattagaacagcaggaggaagacgagatgaagttgctttca
atcaagtccaagttttccgactcgtttaagtccattttgcctgaaggcttcaatgtagaa
gaaacttctgaaaacccttcttctgtatacgagttaagtgctgtaatcacccatgctggt
tcttctgctgattctggccattatcagtcgtttatcaaggatgatctggatttggatggt
gaaagatggtggaaattcaacgatgacaaagtcagttccgttaataaggaaaagatcgag
tcgttggctggaggcggtgaaagtgacagtgccttgattttgatctacaagggacttgga
ttgtag

DBGET integrated database retrieval system