KEGG   Scheffersomyces stipitis: PICST_38082Help
Entry
PICST_38082       CDS       T01023                                 

Gene name
ERK1
Definition
Extracellular signal-regulated kinase 1 (ERK1) (MAP kinase 1) (MAPK 1)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PICST_38082 (ERK1)
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   PICST_38082 (ERK1)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PICST_38082 (ERK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 362 aa AA seqDB search
MNIEQPEQAPARQISFNVSSHYQILEIVGEGAYGIVCSAIHKPSNQKVAIKKIEPFERSM
LCLRTLRELKLLKHFNHENIISILAIQRPVSYEFFNEIYLIQELMETDLHRVIRTQKLTD
DHIQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNSNCDLKVCDFGLARSIASSEDNFGY
MTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEV
LGTPNMEDYYNIKSKRAREYIRSLPFCKKIPFQDLFGNINPNVQINPLAIDLLENLLIFN
PAKRITVDDALKHPYLKLYHDPNDEPVSEKIPEDFFDFDKRKDELSIDDLKKMLYEEIMK
PL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagaacaaccagaacaggcgccagcacggcagatatcgttcaatgtatcgagc
cattaccaaattttggagatagttggcgagggagcatatggaatcgtttgttcagccatt
cacaagcctctgaaccagaaagtagccatcaagaaaatcgagccgtttgagagatcaatg
ctttgccttagaacactaagagaactcaagctccttaagcatttcaaccacgagaacatc
atcagcattcttgctatccagagacctgtgagctacgagtttttcaacgaaatctatctt
atacaagagctcatggaaacagacttacatagagtgatccgcacccagaaactcaccgat
gaccatatccagtatttcatctaccagacacttcgtgcccttaaggctatgcatctggcc
aatgtgttacatagagacctcaaaccgtcaaacttgttgctcaactccaattgcgacttg
aaagtatgtgactttggccttgcccgttccatcgctagtagtgaagacaatttcgggtat
atgactgaatatgtcgcgaccagatggtatcgagcaccagaaatcatgctcactttccag
gagtacaccacggctatcgatgtctggtctgtaggctgtattctcgccgaaatgctcagc
ggtaggcctcttttcccgggcagggactaccacaatcagctttggctcataatggaggtc
cttgggacacctaacatggaagactactacaacatcaagagcaagcgagcacgagagtat
atccgatcattaccgttctgcaaaaagatcccgttccaggacctctttggaaacatcaac
cccaacgtccaaatcaacccgttggccatagacttgttggagaacttgcttattttcaat
cctgccaaacgtatcacagtagacgacgcattaaaacatccttacttgaagctctatcat
gatccaaatgatgagcctgttagcgagaaaatccccgaggacttctttgactttgacaag
agaaaggacgagcttagcattgatgatttgaagaaaatgttgtacgaagaaatcatgaaa
cctttatag

DBGET integrated database retrieval system