KEGG   Scheffersomyces stipitis: PICST_38512Help
Entry
PICST_38512       CDS       T01023                                 

Gene name
FSH1
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00670  One carbon pool by folate
pic00790  Folate biosynthesis
pic01100  Metabolic pathways
Module
pic_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PICST_38512 (FSH1)
   00670 One carbon pool by folate
    PICST_38512 (FSH1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PICST_38512 (FSH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FSH1 BAAT_C Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 4850802
NCBI-ProteinID: XP_001387674
JGI: 38512
UniProt: A3GEV3
Position
1
AA seq 265 aa AA seqDB search
MSNSTSNGRILCLPGFLQSVRVFAEKTTRLKELFAEKKIELEYLDPPRIIESLQALPYYN
SLDKEEADVMWKKTLAKDANKCWFLVKDPHLYYGFEEAVQYIIDHIRVHGPYDGILGFSQ
GCVMATTITNTIHELLPSHPHFKVSILAAGFAMTGRIDDEEMAHNDHSYHPESLEEFQSS
VRLLPAQERYFTPPKDNFNTKLFFIFGRNDFVVPPIRTKYLAHLYDRRSTKLYEHNGGHF
IPREDEFLQQIVKDVSTVVIPTAKI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattctacttcaaatgggagaatcctatgccttcctggattcctccagagtgta
agagtttttgcagagaaaactactagactaaaggaactattcgctgaaaaaaaaatcgaa
ctcgagtatcttgaccctccaaggataatagaatcattacaagccctcccatactataac
ctgcttgacaaggaggaggctgatgttatgtggaaaaagaccctagcaaaagatgctaat
aaatgttggtttctagtcaaagatccccatctttattatggctttgaagaagctgtgcag
tatatcatagaccatattcgagtacatggcccctacgacgggattcttggcttttcccaa
ggttgtgtcatggccacaacaataaccaatactattcacgaactcctaccttcacacccc
catttcaaggtgtctattcttgctgcggggtttgcaatgacaggaaggatcgacgacgaa
gaaatggcccacaacgatcatagctatcacccagagtcgctcgaagagttccagctgagt
gttagattactacctgctcaggaaaggtacttcacgcctccgaaagacaacttcaatacc
aagttgttctttatctttggccgtaacgattttgtggtccctcctatcaggacaaagtat
ttagcacatttgtacgatagaagaagcaccaagctctatgaacataacgggggccacttt
atccccagagaagatgaatttctccagcagattgtgaaggatgtatccacagtggtcatc
cctactgcaaaaatatag

DBGET integrated database retrieval system