KEGG   Scheffersomyces stipitis: PICST_38512Help
Entry
PICST_38512       CDS       T01023                                 

Gene name
FSH1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pic00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pic00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 265 aa AA seqDB search
MSNSTSNGRILCLPGFLQSVRVFAEKTTRLKELFAEKKIELEYLDPPRIIESLQALPYYN
SLDKEEADVMWKKTLAKDANKCWFLVKDPHLYYGFEEAVQYIIDHIRVHGPYDGILGFSQ
GCVMATTITNTIHELLPSHPHFKVSILAAGFAMTGRIDDEEMAHNDHSYHPESLEEFQSS
VRLLPAQERYFTPPKDNFNTKLFFIFGRNDFVVPPIRTKYLAHLYDRRSTKLYEHNGGHF
IPREDEFLQQIVKDVSTVVIPTAKI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattctacttcaaatgggagaatcctatgccttcctggattcctccagagtgta
agagtttttgcagagaaaactactagactaaaggaactattcgctgaaaaaaaaatcgaa
ctcgagtatcttgaccctccaaggataatagaatcattacaagccctcccatactataac
ctgcttgacaaggaggaggctgatgttatgtggaaaaagaccctagcaaaagatgctaat
aaatgttggtttctagtcaaagatccccatctttattatggctttgaagaagctgtgcag
tatatcatagaccatattcgagtacatggcccctacgacgggattcttggcttttcccaa
ggttgtgtcatggccacaacaataaccaatactattcacgaactcctaccttcacacccc
catttcaaggtgtctattcttgctgcggggtttgcaatgacaggaaggatcgacgacgaa
gaaatggcccacaacgatcatagctatcacccagagtcgctcgaagagttccagctgagt
gttagattactacctgctcaggaaaggtacttcacgcctccgaaagacaacttcaatacc
aagttgttctttatctttggccgtaacgattttgtggtccctcctatcaggacaaagtat
ttagcacatttgtacgatagaagaagcaccaagctctatgaacataacgggggccacttt
atccccagagaagatgaatttctccagcagattgtgaaggatgtatccacagtggtcatc
cctactgcaaaaatatag

DBGET integrated database retrieval system