KEGG   Scheffersomyces stipitis: PICST_39246Help
Entry
PICST_39246       CDS       T01023                                 

Gene name
ISW1.2
Definition
(RefSeq) ATPase component of a four subunit chromatin remodeling complex (EC:3.6.1.3)
  KO
K11654  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 [EC:3.6.4.-]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PICST_39246 (ISW1.2)
Transcription machinery [BR:pic03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    NoRC (nucleolar remodeling complex)
     PICST_39246 (ISW1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 860 aa AA seqDB search
MGLGKTLQTISFLGYLRFIKHINGPHIVITPKSTLDNWAREFNRWIPDMKVLVIQGDKDQ
RQELLREQVLTCKFDVIIASYEIVIREKSTFKKFDWEYIIIDEAHRIKNEESLLSQIIRM
FHSKNRLLITGTPLQNNLRELWALLNFILPDVFADNESFDEWFQSDEDKNDSEDTVVSQL
HKVLKPFLLRRIKADVEKSLLPKQELNVYVKMSEMQRKWYQKILEKDIDAVNGANKKESK
TRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYNSQKMIILDQLLRKFQKEGSRVL
IFSQMSRMLDILEDYCFFREFKYCRIDGQTEHADRINAIDEYNKPGSDRFVFLLTTRAGG
LGINLTSADIVVLFDSDWNPQADLQAMDRAHRIGQTKQVKVFRFVTENAIEEKVLERATQ
KLRLDQLVIQQGRNTGGLDGQQSSKSASKNELLDMIQYGAADMFASSDSANGEVDIEDLL
KHSESKTKELTEKYAQLNLNALQHFTNDESVYEWNGENFKKKEPTAITNIGHAWINPGKR
ERKENYSIDMYYKDVLNTGGRAASSGASKSGPRPPKQLIIYDHQFYPAKLLELHELEKNY
YKKQIRYKVPLKAGDSSTLKERELEQKLEQEEINNSRALTEEERALKEDLLTQGYSNWNR
RDFTHFIAVCTKYGRNSIPLIATEFEDKSLEEVREYAKAFWSNYEEIEGYERYISQIEAG
EEKILKIKLQKEALRRKLSQYKYPLQELVLKFPPATTNKRIFSDEEDRFLLVQLYRYGLD
TPDVYERIKEAIRDSPLFQFDFFIQSRNTAEIARRCQTLLGCVLKEIQPNSANANGSATK
RKKEDTPDVDSKKKKQQKKK
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgggacttggtaaaactcttcaaacgatttcgttcttgggttatctccgttttatcaag
cacatcaacggcccacacattgtgattacaccaaagtcgacgttggacaactgggccaga
gagttcaaccgttggattccagatatgaaggtgttggttattcaaggagacaaagaccaa
aggcaggaacttcttcgtgagcaggtgttgacgtgtaagtttgatgtcatcatcgcatcg
tacgagatagtcattcgggagaaatctacgttcaaaaagttcgactgggagtacatcatc
atcgacgaagcccatagaatcaaaaacgaagagtcattattgtctcagattattcggatg
ttccattcgaagaatcgtctcttaattaccgggactcctttacaaaacaacttgcgagag
ttgtgggctcttttgaatttcattcttccggatgttttcgccgacaacgagctgttcgac
gagtggtttcagtcagacgaagacaaaaacgatagtgaagacaccgtagttctgcagttg
cacaaggtcttgaagcccttcttactcagaagaattaaggccgatgtagagaaatcgttg
ttgcccaaacaggagttgaatgtctacgtcaagatgagcgaaatgcagcgaaaatggtac
caaaagattttggaaaaagacatcgatgccgtcaacggagccaacaagaaagaaagcaag
acaagattgttgaacattgtgatgcagttgagaaagtgctgtaaccatccgtacttgttt
gaaggggcagagccaggacctccttacacgactgatgagcatttggtgtacaactcacaa
aagatgataattttggaccagttgttgaggaagtttcaaaaagaaggctccagagtgttg
atcttttcacagatgagcagaatgttggatatcttggaagattactgttttttccgtgag
ttcaagtattgtagaatagatggtcaaactgaacatgcagatagaatcaatgccatcgac
gaatataacaagcctggaagtgacaggttcgtgttcttgttgactaccagagcaggtggt
ttaggtatcaacttgacaagtgctgatattgtagttcttttcgattcggattggaatcca
caggcggatttacaagcgatggatagagctcacagaattggccaaacaaaacaagtcaaa
gtattcagatttgtcacagagaatgccatcgaagagaaagtattggaaagagccacccag
aaacttcgtttggaccaattggttatccaacaaggcagaaacactggaggtttggatggc
cagcaaagttccaaatcagcatcgaagaacgagttgttagacatgatccaatatggagca
gcggacatgtttgcatctagcgattcagcaaatggagaagtggacattgaagatttgttg
aagcattctgagagtaaaacaaaagaattgactgagaagtacgctcaattgaatttgaat
gcattgcagcatttcaccaatgacgagtcagtgtatgaatggaacggagaaaatttcaag
aagaaggagcccactgccataaccaacattggccatgcctggataaatcctggtaaaaga
gaacgtaaggaaaactactctatagacatgtactacaaagacgtattgaacactggaggt
agagcagcttctagtggagcttccaagtctggtcccagaccgccaaaacagttgattatt
tatgatcaccaattctatcctgctaagttgttggagttgcatgagttggaaaagaactac
tataagaaacagatcagatacaaggttcctttgaaagctggagattctctgacattgaaa
gaacgtgagttagaacagaagttggaacaggaagaaatcaacaattctcgggctttgaca
gaagaggaaagagctttgaaagaagacttgttaacccaaggttatagtaattggaaccga
agagactttacgcacttcattgccgtctgcacgaaatatgggcgtaattcaattccgttg
atagctacggagtttgaggataagtccttggaagaagtccgtgaatatgcaaaagccttc
tggctgaactacgaggagatcgaaggctacgaaaggtacatctcgcagatcgaagctgga
gaggagaaaatcttgaagatcaaactccagaaagaagcgttgagaagaaaattgtctcag
tacaagtatccactacaagaattggtattgaaatttccacctgccacaaccaataagagg
atattcagcgacgaagaggaccgctttttacttgtccaattatacagatatggattggac
actcctgacgtatacgagagaataaaggaagctatacgagactcacctttgttccagttt
gatttctttattcagagcagaaacactgctgaaatcgcaagaagatgccagacattactt
ggatgtgttttgaaggagattcaaccgaattctgcaaatgccaatggtagtgctactaaa
agaaagaaggaagacactcctgacgtagacagtaagaaaaagaaacaacaaaagaagaag
tag

DBGET integrated database retrieval system