KEGG   Scheffersomyces stipitis: PICST_40600Help
Entry
PICST_40600       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pic  Scheffersomyces stipitis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PICST_40600
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PICST_40600
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PICST_40600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 530 aa AA seqDB search
PSSSPPVSASHSQINSDIQARLLAFQQKRSKPVDHSGSPSLSGSHSMTNSPNNTSLNLAS
INTYHESDSDRHLPMTPDVGRNLSGRGKHNFRLNLDSTNSDLPVNNGSNGTAMSQNSSLN
RNDSLRSISSDGSIGSDSEADKKPQLQGLFANYSKYLDIKSGSLNFAGKASLHSKGVDFS
SGSSFRISLDELEYIDELGRGNYGSVSKVLHKPTGVLMAMKEVRLELDETKFTQILMELD
ILHKCDSPYIVDFYGAFFVEGAVYMCIEYMDGGSLDKIYGKEHGVKDEASLAYITESVIR
GLKDLKDEHNIIHRDVKPTNILINTAGKVKLCDFGVSGNLVASLAKTNIGCQSYMAPERI
KSMNPDDATYSVQSDIWSLGLTILEVAAGHYPYPAETYDNIFSQLSAIVDGEPPQLDPKI
YSKEAQIFVKSCLKKNPDLRPSYAALLKNPWLLKYRDVDPHMDVSVSKRVHELEEDKEKR
NVSRSNSLKKNPLPTPANIESVHSLLRNKVKAPALHRGGLPNNNRSFLHK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
ccttccctgtctccccctgtttctgcttcacattcgcaaataaacagcgatattcaagcg
cgactattggcattccagcagaagagaagcaagcccgtagaccattccggctctccatca
ctctctggaagccacagcatgacaaattctcccaacaatacatctctcaatcttgccagt
atcaatacttatcacgaatctgactctgatagacatcttcctatgactcctgatgtgggc
agaaatttatctggacgaggaaaacataacttcaggttgaatctagatagtaccaacagt
gatcttccggttaataacggaagcaacggcacggccatgtctcaaaatagcagtttgaac
cgaaacgattcgttgcgtagtatatccagtgatggtagtataggctctgattccgaggct
gataagaaaccacaattgcaaggactattcgctaactactccaaatacttggatatcaag
tctggactgttaaatttcgctggaaaggcatcgttacattctaagggtgtggattttctg
tcgggatcttcattcagaatatctctagatgaattggagtacatcgatgagttgggccgt
ggaaattatggctcagttctgaaagttttacataagcctaccggagttctcatggcaatg
aaagaggtccgtcttgagttggacgaaacgaagttcacacagatcttgatggagcttgac
attttacacaaatgcgattctccgtacattgtcgacttttacggcgccttctttgtagaa
ggagctgtctatatgtgtattgagtacatggatggaggctccttagataagatctatggc
aaggagcatggggtcaaggatgaagcttcgttggcctatattactgaaagtgtcattcgt
ggtcttaaagacttgaaagatgaacataatatcatacatcgtgatgtgaaaccaacgaat
atcttaatcaatactgctggaaaggtcaagctttgtgactttggtgtatctggaaatttg
gttgcatctttggctaagactaatatcgggtgtcaatcatacatggctccagaaagaatc
aagagtatgaacccagacgatgctacttactcggtacaatctgatatctggtctcttggt
ttgaccatcctagaggttgccgcaggccattacccatacccagcggaaacgtatgataac
attttctctcagctcagtgctattgtagatggcgagccacctcaattagatcctaagatt
tattcaaaggaagcacagatatttgtaaaatcctgtttgaagaagaacccagatttgaga
ccatcatatgccgcgctcttgaaaaatccttggttgttgaagtatcgtgacgtagatcca
cacatggatgtgctggtttccaagagagttcatgaacttgaagaagacaaggagaagcgc
aatgtgagcagatccaatagtttgaagaaaaacccactcccaactccagctaatatcgag
agtgtgcattccttacttcgaaacaaggtcaaagctcctgctttgcatagaggtggatta
ccgaacaacaaccgatcatttttacataagtag

DBGET integrated database retrieval system