KEGG   Scheffersomyces stipitis: PICST_40781Help
Entry
PICST_40781       CDS       T01023                                 

Gene name
URO1
Definition
peroxisomal urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_40781 (URO1)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PICST_40781 (URO1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PICST_40781 (URO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 304 aa AA seqDB search
MSELVASSYGKANVKFLKVKKNPSNPDEQEVLEANVQCLLKGDFDIAYTKADNAPIVPTD
TVKNTILVEAKNTDVWPIERFAAHLAKHFTGKYSQVHSVEITIVQSRWSKFPLSNGKVHP
HSFRYDGPETKRTFLTYDKFSKKLTLTSAIKDLTVLKSTGSMFYGYNVCDYTTLAPTTDR
ILSTDVYALWTFDPKAVPTLDSVLQKADEGLFDSTYDKARNTTLEMFALEKSASVQATMY
NMSHSILEQVPEVATVSYELPNKHYILFNLEWKGIKGNKELFYPSPDPNGLIRSTVGRKG
AAKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattggttgctagttcttatggtaaggccaacgtcaagttcttgaaggtcaag
aagaacccctctaacccggatgaacaagaggtattggaagcaaatgttcaatgtctcttg
aaaggagacttcgatattgcctacactaaggccgataatgctcctattgtccctacagat
accgttaagaacacgattttggtggaagccaagaataccgacgtgtggccaattgaaagg
tttgctgcccatttggccaagcacttcactggtaaatactcccaggtccacagtgttgag
atcacaatcgtgcaatccagatggagcaaatttcctttgctgaatggtaaagttcaccct
cattctttcagatatgacggtcctgaaacaaagagaaccttcttgacctacgacaagttc
tccaagaagttgactcttacctccgccatcaaggacttgacagtattgaagtccactggc
tcgatgttctacggctataatgtgtgtgactataccacattggctcctaccacggacaga
atcctctcgacggatgtgtatgccttgtggactttcgaccctaaggctgttcctaccttg
gattctgttttgcagaaggcagatgaaggattgtttgattccacatatgataaggccaga
aacaccacattagagatgtttgctttagaaaagtcagcttctgtgcaagcaactatgtac
aacatgtcccacagcatcttggagcaggttccagaggttgcaacagtgtcctatgagttg
cctaacaaacactacatcttgttcaacttagaatggaagggcattaagggtaacaaggag
ttgttctacccatctccagacccaaacggcttgatcagatccaccgtaggcagaaaagga
gcagccaagttgtga

DBGET integrated database retrieval system