KEGG   Scheffersomyces stipitis: PICST_40781Help
Entry
PICST_40781       CDS       T01023                                 

Gene name
URO1
Definition
peroxisomal urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pic00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 304 aa AA seqDB search
MSELVASSYGKANVKFLKVKKNPSNPDEQEVLEANVQCLLKGDFDIAYTKADNAPIVPTD
TVKNTILVEAKNTDVWPIERFAAHLAKHFTGKYSQVHSVEITIVQSRWSKFPLSNGKVHP
HSFRYDGPETKRTFLTYDKFSKKLTLTSAIKDLTVLKSTGSMFYGYNVCDYTTLAPTTDR
ILSTDVYALWTFDPKAVPTLDSVLQKADEGLFDSTYDKARNTTLEMFALEKSASVQATMY
NMSHSILEQVPEVATVSYELPNKHYILFNLEWKGIKGNKELFYPSPDPNGLIRSTVGRKG
AAKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattggttgctagttcttatggtaaggccaacgtcaagttcttgaaggtcaag
aagaacccctctaacccggatgaacaagaggtattggaagcaaatgttcaatgtctcttg
aaaggagacttcgatattgcctacactaaggccgataatgctcctattgtccctacagat
accgttaagaacacgattttggtggaagccaagaataccgacgtgtggccaattgaaagg
tttgctgcccatttggccaagcacttcactggtaaatactcccaggtccacagtgttgag
atcacaatcgtgcaatccagatggagcaaatttcctttgctgaatggtaaagttcaccct
cattctttcagatatgacggtcctgaaacaaagagaaccttcttgacctacgacaagttc
tccaagaagttgactcttacctccgccatcaaggacttgacagtattgaagtccactggc
tcgatgttctacggctataatgtgtgtgactataccacattggctcctaccacggacaga
atcctctcgacggatgtgtatgccttgtggactttcgaccctaaggctgttcctaccttg
gattctgttttgcagaaggcagatgaaggattgtttgattccacatatgataaggccaga
aacaccacattagagatgtttgctttagaaaagtcagcttctgtgcaagcaactatgtac
aacatgtcccacagcatcttggagcaggttccagaggttgcaacagtgtcctatgagttg
cctaacaaacactacatcttgttcaacttagaatggaagggcattaagggtaacaaggag
ttgttctacccatctccagacccaaacggcttgatcagatccaccgtaggcagaaaagga
gcagccaagttgtga

DBGET integrated database retrieval system