KEGG   Scheffersomyces stipitis: PICST_40866Help
Entry
PICST_40866       CDS       T01023                                 

Gene name
UGP1
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pic  Scheffersomyces stipitis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PICST_40866 (UGP1)
   00052 Galactose metabolism
    PICST_40866 (UGP1)
   00500 Starch and sucrose metabolism
    PICST_40866 (UGP1)
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_40866 (UGP1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PICST_40866 (UGP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 471 aa AA seqDB search
MRNALNNLADTVENPDHQQRFENEMDSFFALFRRYLADKASGSTLDWEKIKSPSPNEVVQ
YNSLNESAATNLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEHLNRKY
DADVPLLLMNSFNTDNDTAKIIKKYQGHRIRVKTFNQSRFPRIYKDSLLPVPDSYDDELD
SWYPPGHGDLFESLVQSGELDALLAQGREILFVSNGDNLGATVDTKILDHMIETGAEYIM
ELTNKTRADVKGGTLINYEGSVRLLEIAQVPKEHVEEFKSIKKFKYFNTNNLWINLRAIK
KLVEHNAIEAEIIPNQKTISKGNVDINVLQLETAVGAAIRHFQGAHGVVVPRSRFLPVKT
CSDLLLVKSDLFFLEHGALKLDPTRDGFANPLIKLGSHFKKVSGFQSRVPHMPKILELDH
LTITGNVTLGRGVTLKGTVIIVCNDGDKIDIPNGSILENVVVTGNLTILEH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgccttgaacaacctcgctgacaccgtcgagaaccccgaccaccagcagaga
ttcgaaaacgagatggattcgttctttgctcttttcagaagatacttggccgacaaggct
tccggctctactttggactgggagaagatcaagtctccttctcctaatgaagtcgtccag
tacaatctgttgaacgaaagtgccgccacaaacttgtccaagttggcagtgttgaagttg
aacggtggtttaggtacatctatgggttgtgttggtcctaaatctgtcattgaagtcaga
gacggtaacacgtttttggacttgtccgttagacagatcgagcacttgaacagaaagtac
gatgctgatgttcctttgttgttgatgaactcgttcaacaccgacaacgacacggccaag
atcatcaagaagtaccagggccacagaatcagagtcaagaccttcaaccagtcgagattc
ccccgtatctacaaagattctcttttaccagttcctgactcgtacgatgatgaattggac
tcatggtaccctcctggccatggtgacttgttcgagtcattggttcaatctggagaattg
gatgcccttttggctcagggcagagaaatcttgtttgtctccaatggtgacaacttgggt
gccactgttgacaccaagatcttggaccacatgatcgaaactggtgccgagtatatcatg
gagttgaccaacaagaccagagccgacgtcaaaggtggtaccttgatcaactacgaagga
tccgtcagattgttggaaatcgctcaggtgcctaaggaacacgtagaagagttcaagagc
atcaagaagtttaagtacttcaataccaacaacttgtggatcaatttgagagccatcaag
aagttggtggaacacaatgccatcgaggccgaaatcattcctaaccaaaagaccatatct
aaaggaaacgtagacatcaacgttttgcaattggaaaccgctgtcggtgctgccatcaga
cacttccaaggtgcccatggtgttgtcgttccaagatcgagattcttgcctgtcaagacc
tgttctgatttgttgttggtcaagtctgacttgttcttcttggaacacggtgcattgaag
ttagatcctaccagagatggatttgccaatcctttgatcaagttgggctcccatttcaag
aaggtcagtggcttccagctgagagttcctcacatgcctaagatcttggaattggaccat
ttgactatcactggtaacgtcactttaggtagaggtgtcaccttgaagggtactgttatc
attgtctgtaacgacggtgacaagatcgatattcctaacggttccatcttagagaatgtt
gtggttactggtaacttgactatcttggaacattag

DBGET integrated database retrieval system