KEGG   Scheffersomyces stipitis: PICST_41505Help
Entry
PICST_41505       CDS       T01023                                 

Gene name
LAG1.2
Definition
Longevity-assurance protein 1 (Longevity assurance factor 1)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pic  Scheffersomyces stipitis
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PICST_41505 (LAG1.2)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PICST_41505 (LAG1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 354 aa AA seqDB search
MQSNESLERERIYQKSFLASVERNQIPISRTILLSLYFLHYTSPVFHSYTSKFLYLQNQT
DIIFDAKTGKAHPLYDISIDDAYYVGFYVIALTFLRSILMQWCFSPIASRFCQIYSNKAK
VRFAEQSWSFVYYSFSFIYGVLLYVHSPYFLNLDNVYLGWPNFPMTASFKRYYLISIGFW
LQQIFVLNIEQKRKDHYQMFSHHIITCLLIIGSYYYYYFRIGHLILMIMDSVDICLSGAK
MLRYAGFSTACDVMFLFFLIAWIVLRHGVYNYIFYHAYSKAEFLMADGECIPGAIQKRCW
TPAVINFFLSLLGGLQIITIIWMYLIMKVAIKVIAGLGAEDVRSDEDDTELEDD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgaacgagtcgctcgaaagagaaagaatataccagaaatcgttcttggcgtca
gtagaacggaatcagatccccatatcccgtacaattctactctcgctatactttctccat
tacacatcaccagtcttccactcgtacacgtccaagtttctctatttgcagaaccagacg
gacatcatcttcgatgccaaaacaggaaaagcgcatcccctctacgacataagcatcgat
gatgcttactacgttggcttctatgtgatcgccttaacttttctcaggtccattctcatg
caatggtgtttcagccctatcgcttcgagattttgccagatctactccaacaaggctaaa
gtcagatttgccgaacaaagttggtcatttgtctattattctttttcatttatttacggg
gtgttgttgtatgtccattcgccgtacttccttaatttagacaacgtctatcttggatgg
cccaatttcccaatgacagccctgttcaaaagatactatctcatctccataggcttctgg
cttcaacaaatctttgtgttgaacatcgagcagaagagaaaagaccactaccagatgttc
agccatcacatcatcacgtgtttgttgatcattggttcctactactattactacttccgc
atcggccatctcatcctcatgatcatggactccgtagatatctgtttatcgggtgcaaag
atgttgagatacgctggcttctccactgcatgtgatgtcatgttcctctttttcttgata
gcctggatcgtcttgagacacggagtgtacaactacatcttctaccatgcctacagtaaa
gctgagttcttgatggctgatggcgaatgcatacccggcgcaattcagaagagatgctgg
acaccagcggttatcaacttcttcttgtcgttattgggaggcttacagatcatcacaatc
atctggatgtacttgatcatgaaggtagccatcaaggttattgctggtttgggagctgaa
gatgtaagaagtgacgaagatgatactgaattggaagatgac

DBGET integrated database retrieval system