KEGG   Scheffersomyces stipitis: PICST_41797Help
Entry
PICST_41797       CDS       T01023                                 

Gene name
YUH1
Definition
ubiquitinyl hydrolase 1 (EC:3.1.2.15 3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 244 aa AA seqDB search
MAAGDSKSVIPLESNPAIFSELAFKLGLSPVVDFHDVYSLTDTELLAFLPNPVYAVILLF
PLTESYENYRKTEDSNIPQAYHNQHIETIKWFKQTIGNGCGLYALLHALGNLPNDLIISN
SVLSSLLAKLDQRVSVEEVSKIVEDLEASIKLDQNYGEKGQTSVPAADEEIYFHFITFVK
GKDNHLYELDGRRNGPIDLGPTDEHNTSIISVPQLTEKIQFYINNADEANKHNFAMMAIG
PSLD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgctggtgattccaagtctgtgattcctctcgaatccaaccccgcaattttcagc
gaattagcattcaaacttggcctttctccagttgtagactttcacgatgtctattctctc
acagacactgagttgttagcgttcttgcccaatcccgtctatgccgttatattgctcttt
cccttgaccgagtcatacgaaaactacaggaagaccgaggatctgaacattccacaagct
tatcataatcaacatattgaaaccatcaagtggtttaaacagaccattggaaatggctgc
ggcttatacgcacttttacatgctttgggaaatttgcccaatgatctcataatatctaac
ctggtcttgtccagcttgttggcgaagttggaccaacgtgtttctgttgaagaagtttca
aaaatcgtagaagatctagaagcatcaatcaaacttgatcagaattacggtgaaaagggc
cagacttctgttcccgctgcagacgaagaaatttacttccatttcatcacttttgtcaaa
ggaaaggacaatcatttgtatgaactcgatggaaggagaaacgggccaattgatcttggt
cctactgacgaacacaataccagcattatctcagttccacaattgaccgagaaaatacag
ttttacatcaataatgcggatgaggcaaacaagcacaactttgccatgatggccattggc
ccatcgttggattaa

DBGET integrated database retrieval system