KEGG   Scheffersomyces stipitis: PICST_42966Help
Entry
PICST_42966       CDS       T01023                                 

Gene name
PLC1
Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1 (Phosphoinositide phospholipase C) (PLC-1) (Phospholipase C-1) (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PICST_42966 (PLC1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PICST_42966 (PLC1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PICST_42966 (PLC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 943 aa AA seqDB search
MNTRDERSTSCVGNNDNNNINICVSPTELTVTDEYVPAIIRRSNSSPISSDLTSLFTNLR
TNEAKDTSMSDSSSRMSIKKLLHFSKSDDDLNESTKSVRSNGIFGRRSSGSKSPSSTGDA
SNDEILADVELNPLLAKSIGHIKIPDIFLKEGLPLLKVSQNSKKRILFKIDPINFKFTWK
NAFSSVSMSASSTLQRLVVPNAMHSTKAKMYEFSLDNIKTIAFQKDGSNYREELHISKEF
EDQWITIVYFNEKKGKMKSLHLLADTEHDFKRISNSIKNLRSLRHDLARELFVDFKESDK
SEKDKIVKGMIEESDKSVREFLSFEDILKYSKRLNININRGYLRSIFDEVKKVNDKEDEV
CGNGLNFDQFKLFVSTLKKRSDIMEIWSLVCGSGQSMTLEIFKQFIIQVQKDSIENAVLH
KIFKKFCVDTLDYWLPENFNNFLLSKYSTAIQQIEDEEQYMSYPLSEYYISSSHNTYLVG
RQVAGDSSVEGYIRALQRGCRCVEVDVWDGEVAESEEGVQFQHDKEPIVNHGRTFTTAIS
FSNVISTIKKYAFFTSPYPLVISLEINCSVASQRKIVDILKNTLGDTLIATPILDNATLP
SPNELKHRILLKVKKTSPFHNLIPMDGSYTTGTSTSTTTTTSFSEDNGTGRSSSFSVRSK
TKSTKIIDELSDLGVYFQGLKFRNFSLPESKTYNHCFSLSEKSINSMLKDETKKASIDKH
NRRYLMRVYPSKIRVRSSNFLPLKYWEHGVQMVATNWQTYDLGQQISEAMFDSVGRKGYV
LKDTSLRKPLLKSLRKQVSKYSPGTFEVKFDFEIISAHQLPKSKGEENAINPFVQFEIIG
ATTIEWDDNSMALGKTKIVSENGFNPRWNQTFSGKMTAANNLVFVKFTIFASESKTEEIE
ASPIGICVARLNNLKRGYRYLNVNDLFGEELVYSSLFVKIQYG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcgagatgagagatcaacctcttgtgttggcaacaacgacaacaataacata
aacatatgtgtcagccccacagaattgactgttaccgatgagtatgtccctgctataatt
cggcgaagcaactcttctcctattctgtcagatttaacctcgttattcactaacttaaga
actaatgaggccaaggatactctgatgtcagattcgtcgtctagaatgtctatcaagaag
ttgttgcattttagcaaatccgacgacgacttgaatgaatcaacaaaatctgtgcgatca
aatggtatcttcggcagacgatcttctggatcaaagagcccaagttcaacgggagatgct
tctaatgacgaaatattagctgatgtggaattgaatccgcttttagcgaaaagtataggt
catatcaagatccctgatatttttctcaaggagggtctacctttactcaaagtttcccag
aactcaaagaagaggatattgttcaagatagacccgatcaacttcaagttcacctggaaa
aatgcattttcctctgtttccatgtcggcttcaagtacattgcagagattggtggtaccc
aatgcgatgcatagcacaaaggcgaagatgtatgagttttccttggacaatatcaagact
atagcttttcaaaaggatggctcaaattatagagaagaattgcacatttcgaaggaattt
gaagatcaatggattactattgtttacttcaatgagaaaaaaggaaagatgaaatccttg
cacttattggcggatacagaacatgacttcaaaaggataagcaattcaataaagaacttg
agaagtttgcggcatgacttagcacgagaactttttgtcgatttcaaggaaagtgacaag
agcgaaaaggataagattgttaaagggatgatcgaggagagtgataagagtgttagagaa
ttcttgtcttttgaagacattctcaaatattccaagcgtttgaatattaatataaacagg
ggttatcttcggtctatttttgatgaagtcaaaaaagtcaacgataaagaagacgaagtt
tgtggaaatggtctaaattttgatcaattcaaattgttcgtgtcgactttgaagaagaga
agcgatatcatggaaatctggagtttggtttgtggatctggtcaatctatgactttggaa
atattcaagcaattcatcatccaagttcagaaggatagtattgaaaatgcagtgctacac
aagatttttaaaaaattctgtgtggataccttggactactggcttcctgaaaacttcaat
aactttctcctatctaaatattctactgctatacaacaaatagaggatgaagaacagtat
atgagttatccattgagcgagtattacatctcatcgtcccataatacgtatttggtggga
agacaggttgcaggggattcttccgttgagggatatattagggccctacagcgtggatgt
aggtgtgtcgaggttgatgtgtgggacggggaggtagcagaaagtgaggaaggagtacag
tttcaacatgataaagagccaattgtcaatcatggtaggacattcacaactgcgatttct
ttctcgaatgttatcagtaccattaaaaagtatgcatttttcacgtctccataccccctt
gttattagcttagaaatcaattgttctgtagcatctcagagaaagattgtggatattttg
aagaacacattaggagatacattaattgctactccaattttagacaacgccacattacca
agtcctaatgaattgaagcacaggatactccttaaagtgaagaaaacaagcccatttcac
aacttgattccgatggatggtagttatacgactggaacttcgacctcgacaaccacgacg
acttcttttagtgaggataatggaactggcagatcatccagctttagtgtccgaagcaaa
accaaatcaacaaaaattatagacgaattaagtgatcttggagtatattttcagggtctc
aaatttcgaaacttttccctaccagaatccaaaacatacaatcactgtttctcgttgagc
gagaaatcaataaattcgatgttgaaggacgaaactaaaaaagcgtcaattgataagcac
aatagaaggtatctcatgcgagtttatccatctaagattcgagtccgttcatccaatttt
ttgccccttaagtattgggagcatggggtccaaatggttgcaacgaattggcaaacctat
gatttagggcagcaaataagcgaggctatgtttgacagtgtcggaagaaaaggctatgtt
cttaaggacacttcgctaagaaagcctttgcttaaatccttgagaaagcaagttctgaag
tattcccctggaacttttgaggtgaagtttgattttgaaatcattagcgctcatcaatta
ccaaaatcgaaaggtgaagaaaatgccatcaatccgtttgtgcaatttgaaataatcggg
gcaaccacaattgagtgggatgataattcaatggctctaggcaaaaccaagatcgtatct
gagaatggatttaaccctaggtggaaccaaacattcagtggaaaaatgactgcagcaaac
aatctagtgtttgttaaatttactatatttgcttcagaatctaaaactgaagaaatcgaa
gcaagtccaattggaatttgcgttgctagacttaataatttgaagaggggctatagatat
cttaatgttaatgatctatttggggaagagttagtttactcttcgttatttgttaagatt
cagtacggttaa

DBGET integrated database retrieval system