KEGG   Scheffersomyces stipitis: PICST_43722Help
Entry
PICST_43722       CDS       T01023                                 

Gene name
PHO82
Definition
vacuolar alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PICST_43722 (PHO82)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PICST_43722 (PHO82)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_43722 (PHO82)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 501 aa AA seqDB search
MANFVFPKICNLSILALAVYLYLFDVTVAAPVDNSKETKKNIIFLISDGMGAASVQLARS
FRQVRDDLPYNDLLELDNYLIGTFRTKSNSSYVTDSAAAGTALATGFKSYNKAINVDPEG
KPVGSIGEALKLQGYAIGIVVTTKVTDATPSVWAAHAIDRSSEPLIAEQLLGDHPLGRIP
DLILGGGRAQFVPATEEGGARKDSRNLIEEVQTNGTWSYVGDRESFDQLQGGDNVTLPLL
GLFADKDFPYRIDREDSEYPSLVEETQVALKALSKATEDSEKGFFLLVEASRPDHAGHGN
DAPSIAREVLEFDDVVTEVLKFVEESETETIVIATADHETGGLAVFGRSPKDYQAILNAT
HSSEFLVNAIDEFEQKDNDDEFRKFIQQTVIEQGLGLTNYTQEEVDILVNGARNEDQNLQ
VAIGNLTNSRSEVSWGSTDHTAVDVDIYSYSNSPILFQKILNTKDGLLGTHENTDFSVFI
KSITGIDLEEVTDKIQNVTLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctaactttgtctttccaaaaatttgcaacctctcgatccttgctttagcggtttac
ttatacttgtttgatgttacagttgctgctcctgttgacaactccaaggagaccaagaag
aacatcatcttcttgatttcagatggtatgggagctgcttcagttcaattggctagatcg
tttagacaggtacgtgacgaccttccatacaacgacttgttggaattggacaactacttg
attggtactttcagaaccaagtccaactcctcgtatgtgactgactctgctgctgctggt
acggccttggcaactggtttcaagtcttacaacaaggccataaacgttgacccagaagga
aagccagtaggatctatcggtgaggctcttaagttgcagggttatgctattggtattgtt
gttaccactaaggtcacagacgctactccatctgtttgggctgcacatgccatagataga
agcagtgaaccattgattgcggaacagttattgggtgaccatccattaggtagaattcct
gacttaattcttggtggtggtagagcacagttcgttccagcaacagaagaaggtggtgct
cgtaaggattccagaaacttgatcgaagaagttcaaaccaacggaacttggagctatgtc
ggagacagagaatcgtttgatcaattgcaaggtggtgacaatgtcacattgccattgttg
ggattatttgctgataaagatttcccatacagaattgaccgtgaggattctgaataccct
agtttagtagaagagacacaagtcgcattgaaagctttgagcaaggctactgaagactcc
gaaaaagggttcttcttgttggttgaagcatctagacctgatcatgctggccatggtaat
gatgcaccatccattgctcgcgaagttttggagttcgatgatgttgtaaccgaagtcctt
aagtttgttgaagaatctgaaactgaaactattgttatcgcaactgctgatcacgaaact
ggaggcttggctgtttttggcagatctccaaaggactatcaagccatcttgaatgctact
cattctagtgaatttttggtgaatgctattgatgaattcgaacagaaggataatgatgat
gagttcagaaagttcatccaacaaaccgtcattgagcaaggcttggggcttactaactac
acccaagaagaagttgacatacttgttaatggtgccagaaatgaagaccaaaatcttcaa
gttgcaattggaaatttaactaattccagatctgaggtttcgtggggttccacagaccac
actgctgttgatgtggatatctactcgtactccaattctcctattctcttccaaaaaatc
ttgaacaccaaagatggattgcttggcactcacgaaaacacagatttcagtgttttcatc
aagtccatcactggtattgatttggaagaagtcacagacaagatccaaaatgttactctt
gcttaa

DBGET integrated database retrieval system