KEGG   Scheffersomyces stipitis: PICST_43722Help
Entry
PICST_43722       CDS       T01023                                 

Gene name
PHO82
Definition
vacuolar alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pic00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 501 aa AA seqDB search
MANFVFPKICNLSILALAVYLYLFDVTVAAPVDNSKETKKNIIFLISDGMGAASVQLARS
FRQVRDDLPYNDLLELDNYLIGTFRTKSNSSYVTDSAAAGTALATGFKSYNKAINVDPEG
KPVGSIGEALKLQGYAIGIVVTTKVTDATPSVWAAHAIDRSSEPLIAEQLLGDHPLGRIP
DLILGGGRAQFVPATEEGGARKDSRNLIEEVQTNGTWSYVGDRESFDQLQGGDNVTLPLL
GLFADKDFPYRIDREDSEYPSLVEETQVALKALSKATEDSEKGFFLLVEASRPDHAGHGN
DAPSIAREVLEFDDVVTEVLKFVEESETETIVIATADHETGGLAVFGRSPKDYQAILNAT
HSSEFLVNAIDEFEQKDNDDEFRKFIQQTVIEQGLGLTNYTQEEVDILVNGARNEDQNLQ
VAIGNLTNSRSEVSWGSTDHTAVDVDIYSYSNSPILFQKILNTKDGLLGTHENTDFSVFI
KSITGIDLEEVTDKIQNVTLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctaactttgtctttccaaaaatttgcaacctctcgatccttgctttagcggtttac
ttatacttgtttgatgttacagttgctgctcctgttgacaactccaaggagaccaagaag
aacatcatcttcttgatttcagatggtatgggagctgcttcagttcaattggctagatcg
tttagacaggtacgtgacgaccttccatacaacgacttgttggaattggacaactacttg
attggtactttcagaaccaagtccaactcctcgtatgtgactgactctgctgctgctggt
acggccttggcaactggtttcaagtcttacaacaaggccataaacgttgacccagaagga
aagccagtaggatctatcggtgaggctcttaagttgcagggttatgctattggtattgtt
gttaccactaaggtcacagacgctactccatctgtttgggctgcacatgccatagataga
agcagtgaaccattgattgcggaacagttattgggtgaccatccattaggtagaattcct
gacttaattcttggtggtggtagagcacagttcgttccagcaacagaagaaggtggtgct
cgtaaggattccagaaacttgatcgaagaagttcaaaccaacggaacttggagctatgtc
ggagacagagaatcgtttgatcaattgcaaggtggtgacaatgtcacattgccattgttg
ggattatttgctgataaagatttcccatacagaattgaccgtgaggattctgaataccct
agtttagtagaagagacacaagtcgcattgaaagctttgagcaaggctactgaagactcc
gaaaaagggttcttcttgttggttgaagcatctagacctgatcatgctggccatggtaat
gatgcaccatccattgctcgcgaagttttggagttcgatgatgttgtaaccgaagtcctt
aagtttgttgaagaatctgaaactgaaactattgttatcgcaactgctgatcacgaaact
ggaggcttggctgtttttggcagatctccaaaggactatcaagccatcttgaatgctact
cattctagtgaatttttggtgaatgctattgatgaattcgaacagaaggataatgatgat
gagttcagaaagttcatccaacaaaccgtcattgagcaaggcttggggcttactaactac
acccaagaagaagttgacatacttgttaatggtgccagaaatgaagaccaaaatcttcaa
gttgcaattggaaatttaactaattccagatctgaggtttcgtggggttccacagaccac
actgctgttgatgtggatatctactcgtactccaattctcctattctcttccaaaaaatc
ttgaacaccaaagatggattgcttggcactcacgaaaacacagatttcagtgttttcatc
aagtccatcactggtattgatttggaagaagtcacagacaagatccaaaatgttactctt
gcttaa

DBGET integrated database retrieval system