KEGG   Scheffersomyces stipitis: PICST_45522Help
Entry
PICST_45522       CDS       T01023                                 

Gene name
CBR3
Definition
NADH-cytochrome b-5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pic  Scheffersomyces stipitis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_45522 (CBR3)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PICST_45522 (CBR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 296 aa AA seqDB search
MEDKRELLKQPLHGIYIPIGLIIFGTLMFGYEYLPYSIGFIVVVCSTQLFFAYKRRSSMD
KVKWQDFELVDKTIIAPMTTIYRFKLNRDDEVLDIPTGHHLACCFTINGKDEVRYYSPIS
NQFDAGFFDIMVKHYEHGVVTKRLAQVAEGQTVKFRGPFGKLDYKPNMAKELGLIAGGSG
ITPILQVITKIITSPDDTTKVKLVFANNSEKDILLRAEIDEIASRYPGFSVEYVLTTPSE
DWTGSSGYVTKEIVEKFLPSPDPENKIFVCGPPEMKKSVAKITADLGYQKESVFFF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaaacgagagcttttgaagcagccattgcacgggatctacatccccataggc
ctcatcatctttggtacgcttatgttcggctacgagtacttaccctattccatcgggttc
atagtagttgtttgttccacgcagttgttttttgcctacaaaagacgttcctctatggac
aaggtcaagtggcaggattttgaacttgttgacaagaccatcattgcgcccatgactacg
atctacagattcaagctcaacagagatgatgaggtgttggatatccctacgggccaccat
ttggcctgttgtttcactataaacggcaaagatgaagtccgctactattcgccaatcagt
aaccagttcgatgccggcttttttgacatcatggtcaaacactacgagcacggtgtcgtc
accaaaaggttggcccaggttgcagaagggcagactgtcaagttcagaggtccttttgga
aagttggactacaaacccaacatggctaaggagcttggtttgatcgctggaggatctggt
atcacgcctattctccaggtgatcacgaaaatcatcaccagccctgacgacaccaccaag
gtcaagttggttttcgctaacaattctgaaaaggacatcttgttgagagcagaaatcgac
gaaatcgcttccagatacccaggcttctccgtggaatacgtattgaccactccttccgag
gactggaccggaagctcaggctatgtcaccaaggaaatcgtagaaaagttcttaccttcg
cctgatcccgaaaacaagatctttgtctgtggccctcccgaaatgaaaaagtcggtggca
aagatcaccgcagacttgggctaccagaaggaatctgttttcttcttctag

DBGET integrated database retrieval system