KEGG   Scheffersomyces stipitis: PICST_45900Help
Entry
PICST_45900       CDS       T01023                                 

Gene name
LAG1.3
Definition
(RefSeq) longevity-assurance protein Acyl-CoA-dependent ceramide synthase
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00600  Sphingolipid metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PICST_45900 (LAG1.3)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PICST_45900 (LAG1.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1 DUF4181
Motif
Other DBs
NCBI-GeneID: 4839015
NCBI-ProteinID: XP_001384010
JGI: 45900
UniProt: A3LSZ6
Position
4
AA seq 406 aa AA seqDB search
MDTYTHRHRGSSVGEINVGDTAAPGLSTMRTSKRQRKMSDARIVALSCESSSDIAILKKI
GIASRELCYRHTWIVPLLVLIASYSTYWLSGVDTRLHRFLEALVVPSYKIPGTDQYGKGE
NDFYFVGFYAIFFTFLREFVVVCVLRPLAKALGIKRESKVKRFMEQGYAIFYYGLSGPAG
LWIMSTLPLWFFETTPFYVNYPHKTHDFYFKVYYLGQAAFWVQQSVVLILQLEKPRKDFK
ELVLHHIITIALIWSSYRFHFTWMGLEIFITMDVSDFFLASSKTLNYLDYAISGPFIFVF
ALIWIYLRHYVNIRILWSVLTEFRTVGEWELNWDTQQYKCYISQPIVFFLIAALQIVNLY
WLFLIFRILSRYIFGGVAKDERSDDDSETEETGEEETGEEEAKKYQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatacctatacccaccgtcaccggggttcctctgtcggagaaataaacgttggtgat
acagctgctccaggtctttccactatgcgtacctccaaaaggcagagaaaaatgtcggat
gcaagaattgtagctttgagctgcgaatcaagctcagatattgcaatattgaagaaaatt
ggcattgcttccagggaattgtgctatagacatacttggatagttccgctccttgtattg
attgcatcatatagtacttactggttgtctggtgtcgatacccggcttcatcgtttcttg
gaagccttagttgttccatcttacaagattcctggaacagaccaatatggaaagggtgaa
aatgacttttatttcgttggtttctacgctattttttttactttcttaagggaattcgta
gtggtgtgcgtattgagacctttggcaaaagctttgggcattaaaagggaatcaaaggta
aaacgattcatggaacagggctatgccatcttttattacggtttatctggtccagccgga
ttatggataatgtcaactttaccactttggttctttgagactacaccgttctatgtcaac
tatccgcacaagactcatgacttctatttcaaggtctattacttaggtcaagctgctttc
tgggttcagcagtcagttgtattgattttacaattagaaaaacctcgtaaggatttcaaa
gaattggtcttgcatcacattatcactattgcgttgatttggagttcgtacagatttcat
ttcacttggatgggcttggaaatattcattactatggatgtttcagatttcttcttagct
tcatcgaagaccttgaactacttggattacgcaatttctggccctttcatttttgttttt
gccttgatttggatttacctcagacactacgtgaacatccgaatcttgtggtctgtacta
actgaattcagaactgtcggagaatgggaattgaactgggatactcaacaatacaaatgc
tacatttcccagccaatcgtctttttcttgattgctgccttgcaaatagtcaatttgtac
tggctcttcttgatctttcgtattctttcgagatacatttttggaggagtcgccaaggac
gaaagaagtgacgacgactccgaaactgaggaaactggcgaggaggaaactggcgaggag
gaagccaaaaagtaccaataa

DBGET integrated database retrieval system