KEGG   Scheffersomyces stipitis: PICST_47423Help
Entry
PICST_47423       CDS       T01023                                 

Gene name
MET22
Definition
3'(2')5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pic  Scheffersomyces stipitis
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pic00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 365 aa AA seqDB search
MSSISAQHPYYKELEIATLAVKRASLLTKKLSDSIGVTQKSGTQTKDDKSPVTVGDYAAQ
AIINYAIQKNFPGDEIVGEEDSDTLREDTDESRKLSGRILEIIEDVQDNTSTYSDKIGTL
ENLQDIYESIDLGISQGGDKGRIWALDPIDGTKGFLRGDQFAVCLALIVDGEVVLGVIGC
PNLPEIILSNEDMTGTVGGLYSAVKGVGSFYTALFDSDKFVPLSKQERIKMTTNTSPASI
KVVEGVEKGHSSHSTQSKIKDILGFNREIVHRQTINLDSQVKYCVLAKGQADIYLRLPVS
DTYREKIWDHAAGNILVYESGGQVGDISGAPLDFGKGRFLQSKGVIAGNTHIFPAVIKAV
EQALN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgatttctgcccagcacccttattacaaggaattggagattgctacattggca
gtcaagcgtgcctcgttgctcactaagaaattgagcgattctataggcgttacacagaaa
tctggaacccagacaaaggacgataaatcgcctgtaactgtaggagattatgcagctcag
gctattatcaactatgctatccaaaaaaactttcctggtgacgaaattgtcggagaggaa
gactcagacactttgagagaagacacagatgaatctcggaagttgtcgggtcgcattctc
gagatcatcgaagatgtccaggacaatacttctacctatagtgacaagattggcacactt
gagaacttgcaagatatttatgagagcatagacctcggtatttcccaaggtggagataaa
ggtagaatttgggcccttgatccaattgacggcaccaaaggattccttagaggcgaccag
tttgcagtgtgtttagctcttattgtagatggtgaggtagtattgggcgttattggctgt
cccaacttgcctgagattatcctttccaacgaagatatgacgggtactgttggaggtttg
tactcggccgtaaagggcgttggttcgttttatacagccttgtttgactctgacaagttt
gttcctttgtcgaagcaagagagaatcaaaatgaccactaacacttcgccagccagtatt
aaagtagtggaaggtgtagaaaagggccattcttctcattcaacgcagtcaaagatcaaa
gacatcttgggtttcaaccgtgaaatcgttcatagacagaccataaacttggattcccaa
gtcaaatattgtgtattggctaaaggacaggctgacatctacttgcgtttaccagtcagt
gatacctatcgtgaaaagatctgggaccatgctgctggtaacatcttggtgtatgaaagt
ggtggtcaagtcggtgatatcagcggtgcccctcttgactttggtaagggcagattcttg
caatccaagggtgtcattgctggtaatacccacatcttccctgctgttatcaaagcagta
gaacaagccttgaattaa

DBGET integrated database retrieval system