KEGG   Scheffersomyces stipitis: PICST_47651Help
Entry
PICST_47651       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pic  Scheffersomyces stipitis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PICST_47651
   03420 Nucleotide excision repair
    PICST_47651
   03430 Mismatch repair
    PICST_47651
   03440 Homologous recombination
    PICST_47651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 247 aa AA seqDB search
MADFYDGEFSGGFTTENAPNSQSEPRTRTSLTPVTIKQINDATQPIPDGNFKVNNVELNM
ISFVGIVRSVDSLPSAISVTIEDGTGTTNVRKWVDENSGTPAEAEEKYRMYLDKYVYVTG
ALKSMSNKSYIQNASVMPVKDHNQVLSHVLSAIHHHLLAQGIKPRPKDEKSLFVSESAST
SAPQLSIKERIMKVVRDHSPSMVEGVPPRLISQIVGIGQDEVTKICTELVDRGELYGGSD
DNTYLLD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttctacgatggcgaattcagtgggggtttcacgactgaaaatgctcctaac
tctcagtctgaacccagaaccagaaccagtttgactcctgttactattaaacagattaat
gatgctacacagccaatcccagacggcaattttaaggtcaataacgtagaattaaacatg
ataagctttgttggaattgtgcgtagtgttgatctgttgccctcagctattctggtgaca
atcgaagatggcaccggtacgactaatgtcagaaagtgggtagatgaaaactccggaaca
ccagctgaggccgaagaaaagtaccgcatgtaccttgataaatatgtctacgttacaggt
gcattgaagtcaatgtccaacaagagttacattcaaaatgcactggtcatgcctgtaaag
gaccataaccaggtcttgtcgcacgtgttaagcgctattcaccatcacttgcttgctcag
ggaatcaagccacgccccaaggatgaaaagctgttgtttgtttccgagtcggcatcgacg
tccgcaccccaattatctatcaaagaacgtataatgaaggtggttagggatcacagtccg
ctgatggtggaaggtgtgcctccaagattgatttctcagatcgtggggattggccaggac
gaagtcaccaagatttgcacagaattggtggatagaggcgaactatacggaggcctggac
gacaacacatatctcttagattaa

DBGET integrated database retrieval system