KEGG   Scheffersomyces stipitis: PICST_47887Help
Entry
PICST_47887       CDS       T01023                                 

Gene name
MPS1
Definition
Protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pic04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 821 aa AA seqDB search
MSFRTRASPTARESPSGLIRSNQSHKRQFANDDDNTFLPPALSSYSIALLNDRTKNSPST
TTSNVTGIYELDFPESAKRVDQLKNRLSVHFKESLPTSSLHLQTDNDIISNGNDIKSNRD
QSVGYISINSSKIQTNTSFHESNQPISSHSSFNNYSAHTHNTSVDEDLMNDGSSSPHTSA
SRTPATTPGSNTSNPGVVNSASRPAVHTIKRMRGARRFGRVLGPPQRASRISDIQDKIDL
DTNSNNAGIEHSNEKEIDLDMEIEVGRSTPPVFSLGEFSPKVKRHTQPTHLLNSNVKSDS
NLNSMSNSTSNTTLKSNDSIHMDLDFSSKEKGEELRRRIEERKALNELEMNYQRLRGSSN
KDRKIEEVIYDFPQDRNSNIDMINEKVPDRQENIASKRISDLFENIQQENMDDIPARGKK
AAAISERKPLSNVEVNTFAVSNNFENFRKPKLPRTSSERPSSSIGPDEQKKKKSIIINGN
HYEKLELLGRGGTSKVYKVKAIANNRLYAIKKVTFDQFDEACVKGFKGEIDLLLKLKHAD
RVVKLIDHAVCEGSIYLVMECGDLDLAHVLQNKLSMHKELDLNFVKYHAIEILNCVKAVH
QSGIVHSDLKPANFLFVRGILKIIDFGIANAVPDHTANIYRESQIGTPNYMAPEAWVEVS
QTFPGLPITDQNNSKQRNTWKVGKPSDVWSCGCMIYQMIYGKPPYGAYSGNQRVMAIMNP
QVKIQFGTKGLGGVAVPTSAIELMQNCLARNPNERWTIEQCLNSDFLSPKIVSESFVRDL
VHSAVNYGYNKRINGGGPMTTDVYDALVDSVLKQIENLNYG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttccgaaccagagcatcgccgacagcgagagaatcgccttcaggcctcatacga
tccaaccagagccataaacgacagtttgccaacgatgacgacaatacgtttcttccacca
gcattgagttcatacagtatagctttgttgaacgatagaacaaagaatctgccgtcaact
accacttctaacgtgactggaatttatgagttggattttccggaactggccaaacgagtc
gaccagctcaaaaaccgactttctgtacacttcaaagagtcgctacctacttcctctttg
catctacagacagacaacgatataatactgaatggaaatgatataaaactgaatagagat
caactggtaggatatatttctatcaacagctcaaaaatccagacgaatacctctttccac
gaatcaaaccagcctatctcgtcacacagttcgttcaataactacagcgctcatacccat
aacacgtctgtggatgaagatctaatgaacgatggttcttcctcaccacatacctcggct
tccagaacacctgccactactccgggaagcaataccagcaatcccggagtcgtcaactct
gcttcgaggccagcagtgcatactattaagagaatgagaggagcaagaaggtttggaaga
gtcttgggtcctcctcagagggcctctagaatcagtgatatacaagataagatagatctc
gatacgaatagtaataatgccggcattgaacacagtaacgagaaagaaatcgacttggat
atggaaatagaagtcggcagaagcacaccaccagtgttttctttgggcgagttttcgccc
aaagtcaagcgtcatactcagccgacgcatttattaaactctaatgttaagtcagatctg
aatttaaactccatgtcaaattctacgtcaaatacaactttaaagtccaatgatagcatc
catatggaccttgatttctcgtccaaggagaaaggtgaagagttgcgccgtcgtatagaa
gaaagaaaggcattgaatgaattggaaatgaactatcagaggttgagaggttcttctaat
aaggaccgcaagatagaagaagttatctatgattttcctcaggatagaaacagtaatatt
gacatgattaacgaaaaagtaccagacaggcaagaaaacatagcgtccaaacgcattctg
gacctcttcgaaaacatacaacaagaaaatatggacgatatcccagcaagaggaaagaaa
gcagcagccatttcggaaagaaagcccttgtcaaacgttgaagttaatacgttcgctgtc
tccaacaatttcgaaaatttcaggaaaccaaaattacccagaacatccagtgaacgccct
tcttcatcaataggaccagatgagcagaaaaagaagaagtccatcattattaatggcaac
cattacgagaagttagagttactcggtagaggtggaacttctaaggtatacaaagtaaag
gctatagccaacaacagattgtacgcaattaagaaagtgacatttgaccagtttgacgag
gcttgtgtaaaaggattcaaaggcgaaatcgacttacttttgaagctcaagcatgctgat
agggtagtcaagttaatagaccatgctgtttgtgaaggatcgatatacttggtaatggaa
tgtggagatcttgatcttgctcatgtattgcagaataaactaagcatgcacaaggagttg
gatttgaattttgtgaagtatcacgctattgaaatcttaaactgtgtgaaagctgttcat
caatctggaattgttcatagtgacttgaagccagccaactttctattcgtaagaggaata
ctcaagatcattgattttggaattgcaaatgctgtacctgatcacactgccaacatctat
cgtgagtctcagattggaacgcctaattacatggcaccagaagcttgggtagaagtaagc
cagacatttcctggattgcctattactgaccagaacaactcgaaacagagaaatacatgg
aaagtaggaaagccatcagatgtttggtcgtgtggctgtatgatctaccaaatgatttat
ggaaaacctccatatggagcgtattctggaaatcaacgagtcatggccatcatgaaccca
caagtcaagattcagtttggaaccaagggactcggaggagtagctgtacccaccagtgcc
attgagcttatgcaaaactgtttggcacgaaaccccaacgaacgttggactattgaacaa
tgtttgaatagtgacttcttgagccccaaaattgtaagtgagagttttgtgagagatttg
gttcacctggcagtgaactatggctacaacaaaagaataaatggaggaggtcccatgacc
accgatgtttacgatgcattagttgattctgttttaaagcagattgaaaacttgaattat
ggatag

DBGET integrated database retrieval system