KEGG   Scheffersomyces stipitis: PICST_50192Help
Entry
PICST_50192       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PICST_50192
Enzymes [BR:pic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PICST_50192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 357 aa AA seqDB search
SNLLQVNDKNFKEIVIDSGKFTFVDFYADWCRHCKNLMPTIEELADVFEPFQDQVQVVKI
NGDKDGKKMSKKYVFKGYPTMLLFHGNDEPVEYDGIRDLQALSNFVQQITGVRLASIKPE
GEVEESKVEQEPTGLIRLNDINFEDKIRETPYSIVVFTATWCQFCQKLKPVLETLVDVVF
ANEKEKIQIAIVELDTEPGDKLSDRYHISTLPTILFFSNEYDEPSIYDGEKELLPLLASI
NEFTDSHRDVEGRLSNTAGRIQEVDNLISQKILQGFKGDLSTAGIELLGEISHLSNENYE
MLPYYKKLVSKIINNEMDFFKNEFSRLATILENDISKLTPNTIDSMQKRSNILSSFI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
tcgaatctcctccaggtgaatgacaaaaatttcaaagagattgtcattgactccggtaaa
ttcaccttcgtagatttctatgctgactggtgtcgtcattgcaagaacttgatgccaaca
attgaagaacttgcagatgttttcgagccattccaagaccaagtccaagttgtgaaaata
aacggagacaaggacggaaagaagatgtctaagaaatacgtcttcaaaggctatccaacc
atgttgcttttccacggcaacgatgaaccagttgaatatgacggtattagggatttgcag
gctttgagcaattttgttcaacaaatcacaggagtcagattagcaagcataaaaccggaa
ggggaggtcgaagagtctaaggtagaacaggaaccaactggtttgattcgattgaatgat
atcaattttgaagacaaaattagagagactccgtattcaattgtagtattcactgccact
tggtgtcaattctgtcagaagttaaagccggtacttgaaactcttgttgatgtcgtattc
gccaacgagaaagaaaaaatacagatagcaattgtggagcttgacacggaacccggagac
aaactaagtgatagataccacatactgacgttaccaacaatcctcttcttcagtaatgag
tatgatgaacctagcatatatgatggtgaaaaggaattattgcctttgcttgccctgatc
aatgaattcacagactcacaccgcgacgttgaaggaaggctttctaatactgcggggaga
attcaagaagttgacaatttgattagccagaagattttacaaggattcaaaggagatttg
agtacagcaggaatagagcttttaggcgaaatttcacatttatcaaatgagaattacgag
atgcttccctattataagaagttggtaagcaagatcataaataatgaaatggacttcttc
aagaatgagttttccagattagcgactatattggagaatgacatctcaaaattgacgcca
aatacaatcgactcgatgcaaaagagatctaatattttatcttcatttatctag

DBGET integrated database retrieval system