KEGG   Scheffersomyces stipitis: PICST_51037Help
Entry
PICST_51037       CDS       T01023                                 

Gene name
ARG2
Definition
acetylglutamate synthase (EC:2.3.1.1)
Orthology
K00618  
amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PICST_51037 (ARG2)
   01230 Biosynthesis of amino acids
    PICST_51037 (ARG2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PICST_51037 (ARG2)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     PICST_51037 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 581 aa AA seqDB search
MSKLKNLNREFISNLKSHKLITDAKRNLILSILKSTTTKREARNYLNKYQNQFDFGDLKI
SSSAKYEQDVSKLTKRDSQRELFVNRYLNKQNPFINIYDDETKLKKIPLRVALFKLKFLN
IDPKEWRGIAETFKRLVNLGISPIVFLDYDHLPTDSFKYNELYMINQVNKVMNYLGKPEE
EGNLKTTVLRSLFTVENKERGPVINSLESILIPLYQGIIPFIQPIIYNAESTFQQFINSN
QLLYSLCESLLDKKDLLSVEKIVMIDPIGGIPSVERNQTSHVFINLSQEYSDIVSELYIG
HIEPDQRDLHLANLNTMHEILTLASSKSGNDDTTGIITTPFIMSVNDDLINPIIYNVLTD
RPIISSSLPSSNNRTPQLSTSILKKGVDVRSYDADNYARKFTLHNLIEDELVDKNRLVAL
LDDSFGKNLDTDSYFDRINNSLATLVIVGDYDGAAIITWEYSGTNKIAYLDKFAIAKKNQ
GLPGLADVIFKIILSSHPHELIWRSRKVNPVNKWYFERCVGSMSSPESQWRIFYTGDIFN
RRIDKRRKRIVGSEAVNISDKLVQYSEICEGIPPSFFSSKE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattgaagaatttgaaccgagaattcatctccaacttgaaaagtcacaagctc
ataaccgatgctaaacggaacttaatactctccatcctcaaatctactactaccaagagg
gaagcccggaattacctcaataagtaccagaaccagtttgattttggcgatttgaagatc
tcgtcatcagcaaaatacgagcaggatgtttccaaattgacaaaaagagactcccagcgt
gagttgtttgtcaacaggtacttgaacaaacagaatccattcatcaatatctacgatgat
gagaccaaactcaaaaaaatccctttgagagtagcattgttcaagttgaaatttctcaac
atcgatcccaaagaatggcgtggcattgccgagactttcaagcgattggtaaatttggga
atttcgcccatagtgtttctagattatgaccatcttcccacagactcgttcaagtataac
gaattgtatatgattaatcaggtcaataaggtcatgaactaccttggaaaacccgaagaa
gaaggaaacctaaaaacgacggttttgcggtcattattcactgtcgagaacaaagaaagg
ggtccagtaattaatagtttggaatctatattgattcccttgtatcagggaattattcct
tttatccagcccatcatttacaatgctgagagtacatttcagcagtttatcaactcgaat
cagcttttgtacagcttgtgtgaatcgttgttggacaagaaggatcttctctcagtggag
aaaatagtcatgattgatcctattggaggaattccctcggttgaaagaaaccagacgagc
cacgtatttatcaacttgtctcaagaatactcggatatagtttccgaattgtatattgga
catattgagcctgatcaacgtgatttgcatcttgccaacttgaataccatgcatgaaatc
ttgacactagcttcctccaaatcgggcaatgatgacacgacggggatcatcaccactcca
ttcatcatgtctgtcaatgatgatctcatcaatccgattatttataatgttttgacggat
aggcccatcatctcttcatctctacctagctccaacaacaggacaccacagctttcaact
tctattttgaagaaaggagtggatgtgcgatcgtacgatgccgacaactatgcgagaaag
ttcactttgcataatttaatagaagatgaactcgtagacaaaaataggttggtagctctt
ctagatgattcgttcggcaagaacttggacacagattcttattttgatagaatcaataat
tcgctagctacccttgtcattgtaggggattacgacggtgctgctatcatcacttgggag
tatagtggtaccaacaagatcgcgtacttggacaagttcgccatagcaaagaagaaccaa
ggattacctggattggcagatgtgatcttcaagataattctcctgtcgcatccccatgag
ttgatatggagatctcggaaagtaaaccctgtcaataagtggtactttgagagatgtgta
ggctccatgagttcacctgagtcccaatggagaatcttttacacgggtgatattttcaac
cgcagaatcgacaagagaagaaagagaatagttgggagtgaagctgtaaacatttcagac
aaattggtgcaatacagtgaaatttgtgaaggcattcctccttctttcttttcgtctaag
gaatga

DBGET integrated database retrieval system