KEGG   Scheffersomyces stipitis: PICST_51037Help
Entry
PICST_51037       CDS       T01023                                 

Gene name
ARG2
Definition
acetylglutamate synthase (EC:2.3.1.1)
Orthology
K00618  
amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:pic01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pic01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pic00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 581 aa AA seqDB search
MSKLKNLNREFISNLKSHKLITDAKRNLILSILKSTTTKREARNYLNKYQNQFDFGDLKI
SSSAKYEQDVSKLTKRDSQRELFVNRYLNKQNPFINIYDDETKLKKIPLRVALFKLKFLN
IDPKEWRGIAETFKRLVNLGISPIVFLDYDHLPTDSFKYNELYMINQVNKVMNYLGKPEE
EGNLKTTVLRSLFTVENKERGPVINSLESILIPLYQGIIPFIQPIIYNAESTFQQFINSN
QLLYSLCESLLDKKDLLSVEKIVMIDPIGGIPSVERNQTSHVFINLSQEYSDIVSELYIG
HIEPDQRDLHLANLNTMHEILTLASSKSGNDDTTGIITTPFIMSVNDDLINPIIYNVLTD
RPIISSSLPSSNNRTPQLSTSILKKGVDVRSYDADNYARKFTLHNLIEDELVDKNRLVAL
LDDSFGKNLDTDSYFDRINNSLATLVIVGDYDGAAIITWEYSGTNKIAYLDKFAIAKKNQ
GLPGLADVIFKIILSSHPHELIWRSRKVNPVNKWYFERCVGSMSSPESQWRIFYTGDIFN
RRIDKRRKRIVGSEAVNISDKLVQYSEICEGIPPSFFSSKE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattgaagaatttgaaccgagaattcatctccaacttgaaaagtcacaagctc
ataaccgatgctaaacggaacttaatactctccatcctcaaatctactactaccaagagg
gaagcccggaattacctcaataagtaccagaaccagtttgattttggcgatttgaagatc
tcgtcatcagcaaaatacgagcaggatgtttccaaattgacaaaaagagactcccagcgt
gagttgtttgtcaacaggtacttgaacaaacagaatccattcatcaatatctacgatgat
gagaccaaactcaaaaaaatccctttgagagtagcattgttcaagttgaaatttctcaac
atcgatcccaaagaatggcgtggcattgccgagactttcaagcgattggtaaatttggga
atttcgcccatagtgtttctagattatgaccatcttcccacagactcgttcaagtataac
gaattgtatatgattaatcaggtcaataaggtcatgaactaccttggaaaacccgaagaa
gaaggaaacctaaaaacgacggttttgcggtcattattcactgtcgagaacaaagaaagg
ggtccagtaattaatagtttggaatctatattgattcccttgtatcagggaattattcct
tttatccagcccatcatttacaatgctgagagtacatttcagcagtttatcaactcgaat
cagcttttgtacagcttgtgtgaatcgttgttggacaagaaggatcttctctcagtggag
aaaatagtcatgattgatcctattggaggaattccctcggttgaaagaaaccagacgagc
cacgtatttatcaacttgtctcaagaatactcggatatagtttccgaattgtatattgga
catattgagcctgatcaacgtgatttgcatcttgccaacttgaataccatgcatgaaatc
ttgacactagcttcctccaaatcgggcaatgatgacacgacggggatcatcaccactcca
ttcatcatgtctgtcaatgatgatctcatcaatccgattatttataatgttttgacggat
aggcccatcatctcttcatctctacctagctccaacaacaggacaccacagctttcaact
tctattttgaagaaaggagtggatgtgcgatcgtacgatgccgacaactatgcgagaaag
ttcactttgcataatttaatagaagatgaactcgtagacaaaaataggttggtagctctt
ctagatgattcgttcggcaagaacttggacacagattcttattttgatagaatcaataat
tcgctagctacccttgtcattgtaggggattacgacggtgctgctatcatcacttgggag
tatagtggtaccaacaagatcgcgtacttggacaagttcgccatagcaaagaagaaccaa
ggattacctggattggcagatgtgatcttcaagataattctcctgtcgcatccccatgag
ttgatatggagatctcggaaagtaaaccctgtcaataagtggtactttgagagatgtgta
ggctccatgagttcacctgagtcccaatggagaatcttttacacgggtgatattttcaac
cgcagaatcgacaagagaagaaagagaatagttgggagtgaagctgtaaacatttcagac
aaattggtgcaatacagtgaaatttgtgaaggcattcctccttctttcttttcgtctaag
gaatga

DBGET integrated database retrieval system