KEGG   Scheffersomyces stipitis: PICST_52077Help
Entry
PICST_52077       CDS       T01023                                 

Gene name
HAT1
Definition
histone acetyltransferase subunit (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PICST_52077 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 382 aa AA seqDB search
MSTSLNAAALQPEQWTVSANEALKLYVTDPDGATNFQASFTYPLFGEAETIYGYKDLVIF
LCFDHFTFYPFLNTKYADKLKDPEIVDVKAVVQKYLPESTIYKDEAKWADAIKNEKDTYQ
IPGELVDSFEQDVEGKLATFDIYKINLKDAAGLELHKRLQILVLLFIEAGSYIDASDDLW
DVYLLYQSEDPSIVGFTTVYNYWKYGGSEKFDNDEQFVRLKISQFVILPMYQGQGLGGQF
YSKLFDIWHKDEKVVEIVVEDPNESFDDLRDRSDLVRLSKSLKLTDITTKLTSEWKEKER
QKLKLEKRQFSRLLELVLLYLFKRNAGSDTKKDIRLFIKKRIYEKNIEGLKTLDDNSKKD
KLQTAYVALEEDYYRILGDIQL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagtctcaatgctgcagctttgcagcctgaacagtggacagtttcagccaac
gaagccctcaagttatacgtgaccgatcctgacggagccactaattttcaggccagtttc
acatatcctctctttggagaagctgagacgatttacggatacaaggatcttgtaattttc
ttgtgttttgaccatttcacgttttatccgttcttgaacacaaagtatgctgataaactc
aaagatcctgagattgtcgatgtcaaggcagtcgtccagaaatacttacctgagtctacc
atctacaaggatgaagccaaatgggcagatgccattaaaaatgaaaaagatacataccaa
attcctggagaattggttgattcttttgagcaagatgtggaaggaaaattggcaacgttt
gacatctacaagatcaacttgaaggacgctgcaggcttggagttgcataaaagattgcag
atcttggtgctacttttcattgaagccggttcgtacattgatgcttctgatgatttgtgg
gatgtgtatcttctctaccaatctgaagatccatccattgttggattcaccactgtctac
aactattggaagtatggtggatctgaaaagtttgacaatgacgaacagtttgtaagattg
aagatttcacagtttgttatattgcctatgtaccagggacagggattgggaggtcagttc
tactcgaaattgtttgacatatggcacaaggatgagaaggtcgtagagatagtagtggaa
gaccccaacgagagctttgatgatttgagagacagatcagatttggtgagattaagtaaa
tcgctcaagttgacagatataactactaaactcacgctggagtggaaggaaaaggagaga
caaaagttgaagttggaaaagagacagttttcccgactcttggagttggttttgctttac
cttttcaagaggaacgcaggcagcgacaccaagaaagacataaggttattcatcaagaag
agaatatacgaaaagaacattgagggattaaagactttggatgacaacagcaagaaggac
aagttgcagacagcctatgttgcacttgaggaggactactaccgaatcttgggagatatc
cagttg

DBGET integrated database retrieval system