KEGG   Scheffersomyces stipitis: PICST_52875Help
Entry
PICST_52875       CDS       T01023                                 

Gene name
HYR1
Definition
Hydroperoxide resistance conferring gene. Sensor and transducer of the hydroperoxide signal to Yap1. Hydroperoxide receptor and redox-transducer (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pic  Scheffersomyces stipitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PICST_52875 (HYR1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PICST_52875 (HYR1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PICST_52875 (HYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 185 aa AA seqDB search
MVPHVSSPSQLAVDSDSGSSKNQTESPFYSFKVANSAGKLIDIANYKGKVVLVVNVASLC
GFTPQYKDLETLYQKYKDRGFEILAFPCNQFGSQEPEDEDKIVVYCQRNFGVTFPIMQKL
DVNGYFEAPIYTWLKNEKRGVVGFKGLRWNFEKFLVDRSGNVVSRYLSTVPPLEFEDAIV
KLLKA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggttcctcatgtttccagcccatcgcaacttgccgttgactccgactcgggcagtctg
aaaaaccagacagaatctccattctactcctttaaagttgcaaatagtgccggaaagctc
atagatatagcgaactataaggggaaagtggttttagtggttaacgtcgcttccctctgt
ggatttactcctcaatacaaagatctagaaacattgtatcagaagtacaaagaccggggg
tttgaaatattggcttttccatgtaaccagttcggttcccaggaaccagaagatgaagac
aaaattgtggtgtactgccaacggaactttggcgttactttcccaataatgcaaaagttg
gatgttaatggctactttgaagctccgatatatacatggttgaagaatgaaaagagaggc
gtagtcggctttaaaggcctcagatggaactttgagaagtttttagtagaccgcagcggc
aatgtcgtactgcgctacttgagcacggttcctcctttggaattcgaagatgctatcgtc
aaattattaaaagcgtag

DBGET integrated database retrieval system