KEGG   Scheffersomyces stipitis: PICST_53466Help
Entry
PICST_53466       CDS       T01023                                 

Gene name
PTM6
Definition
protein mannosyltransferase (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pic  Scheffersomyces stipitis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pic00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 745 aa AA seqDB search
EYRHLSNRKNQESQNEKILEEIISKTESLSISSHDNHASISRVFTMYINPLVLTALSAFV
RLYRIDASNKVLWDEAHFGKFGSYYLKHEFYFDVHPPLGKLLVGLSGYLSGYDGNFSFDS
GIEYGDNCNYVMMRCFNCMFSILCTPIAYKTSESLGFSQLTTWFICLSVIFEMISLTLSK
FILLDSMLLFFTMLAFYCLVNVHNARVKNRLLSRQGTKALILTGFSIGCVCSVKWVGLFV
TSVIGLYIIYDLLIKFYQLISTDQLGLKEYIFHWISRILTLIIYPFVIYLLCFKIHFLVL
NHSGPGDGSISTLLQASLEGNKIKQGPRSVAFDSLVTLRSQGLSPNLLHSHDHSYPEGSQ
LQQITTYGFKDDNNDFVIKADKFLERSSGVVETSDTLLKHGDTIRLMHNKTRCFLHSQPI
SAPISDNHYEVSCISELEVNDFRNSWTVEVQGQEKSESPFFQSESEDEVHPISTNFRLKH
KQLGCYLATTGYSYPSWGFQQGEVVCKYAILSRDKTTWWNIEDHSNNKFETPSESYVPPK
PKFWKEFVLLNYGMLASNNALIPDPDKFDRLSSEWWEWPLLLSGIRLGSWGADDVKYFLM
GNPFITWFSTFSLLIFILYVAACAVMHQRQILSYSVLGENWNELLIQGIFPFLAWFLHYF
PFVVMGRVKYLHHYVPALYFAILVSAFVMETFIRKRLNRVIVCTIYLIAYIMIIASFWYL
KDFSLGMEGPPSKFKKLKFLSSWML
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
gaatataggcatttatcaaatagaaagaatcaagaatcacaaaacgagaaaatcttggaa
gaaataatttctaagacagaatctttatccattagttctcatgataaccatgccagtatt
tccagggtcttcactatgtacataaatcctttggtgttgacagccttatccgcatttgtg
cgattgtatcgtatagatgcatcgaataaagtgctatgggatgaagctcattttggcaag
tttggttcctactacttgaagcatgaattctacttcgatgttcaccctccgttaggaaag
ttactagttggtttatctggttacttgtcaggctatgatggaaattttctgtttgacagt
ggaatagagtatggtgataattgcaactacgtaatgatgagatgcttcaattgtatgttc
agtatattgtgtaccccaattgcttacaagacttccgagtcacttggctttagccaattg
actacctggtttatttgtttactggttatttttgagatgatatcattgacattgtcaaaa
tttattcttttggactccatgttactcttctttacaatgttggctttttactgcttagtg
aatgttcacaatgctagagtgaagaatcggctactttcgcgacaaggaacaaaagctcta
atactcactggattttcaattggatgtgtgtgttctgtaaagtgggtcggactattcgta
acttctgttattggtctctacattatttacgatttattgattaagttctaccaactaata
tctacggaccaacttggactcaaagaatatatttttcattggatttcgagaatattaact
ttaataatatacccgtttgtaatttatttgctatgcttcaaaatccatttcttagtgctc
aaccactctggtccaggagatgggtctatatccacattattgcaggcatcattggaagga
aataagattaagcaaggcccacgatcggttgccttcgactcacttgttacacttagatct
cagggcctctcccccaatttacttcattcacatgatcattcttatccagaaggttcgcaa
ttgcaacagataacaacgtacggcttcaaggacgacaataatgatttcgtaattaaagcc
gataaatttcttgaacgatcttcaggcgtagttgaaactctggacaccctacttaaacat
ggagatacaattagactcatgcacaataaaaccagatgcttcttacattctcaacctatt
ctggcaccaatatcagacaatcactatgaggtatcttgcatatcagaattggaggtaaat
gacttcagaaattcatggacagttgaagtacagggccaagaaaagtctgaatctcctttt
ttccaaagcgagagcgaagatgaagttcatcctatttcaaccaattttcgattaaagcac
aagcaattgggatgctatttggctactacagggtattcatatccttcgtggggatttcag
cagggagaggtagtctgcaagtatgcaatattatccagggacaaaacaacttggtggaat
attgaagaccattccaataacaagttcgagacaccttcggaatcatatgtgcctcccaaa
cctaagttctggaaagagtttgtgttgctaaactacggtatgcttgcctcaaataatgcc
cttattccagacccagataaatttgatagattgagttccgaatggtgggagtggccactc
ttactttctggaattaggcttggctcgtggggagcagatgatgttaagtacttcttaatg
ggtaatccatttataacttggttctcaactttctccttgttgatttttattctttatgtc
gcagcatgtgcggtgatgcatcaaaggcaaatcttatcatatagtgttcttggagagaac
tggaatgaactattgattcaaggaattttcccttttctagcttggtttttgcattatttc
ccctttgtcgttatgggacgagtaaagtatctacatcactatgttccagcactatacttc
gccatattagtaagtgcattcgtaatggaaacattcataagaaagagattgaatcgtgtt
attgtatgcacaatctatttgattgcatacataatgattatagcatctttctggtactta
aaagacttctcattgggaatggagggcccgccaagcaagtttaagaagttgaaatttctt
tcatcatggatgctatga

DBGET integrated database retrieval system