KEGG   Scheffersomyces stipitis: PICST_53620Help
Entry
PICST_53620       CDS       T01023                                 

Gene name
MLS1.1
Definition
Malate synthase, glyoxysomal (MASY)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pic  Scheffersomyces stipitis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_53620 (MLS1.1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PICST_53620 (MLS1.1)
   00630 Glyoxylate and dicarboxylate metabolism
    PICST_53620 (MLS1.1)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PICST_53620 (MLS1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 551 aa AA seqDB search
MSSPFPQTVDKVKGLKILGPLPEGAKHIFNVEALAFVATLHRSFNARRKELLANRKEAQR
LRDSGKLPDFLPETAYIRDDATWTGPPLAKGLQDRRVEITGPTDRKMVINALNSNVATYM
ADFEDSLTPAWNNLVEGQVNLYDGVRRNLTFETNGKKYALNLDPKRHIPTLIVRPRGWHL
EEKHVTVDGEPVSGGIFDFAIYFYNNAVESLKQGFGPYFYLPKMEHHLEAKLWNDIFNYS
QDYIGIPRGTIRASVLIETLPAAFQMDEIIYQLRQHIAGLNCGRWDYIFSYIKSLRNHPE
FILPDRSQVTMAAPFMSSYVKLLVHTCHKRQVHALGGMAAQIPIKDDPERNRLALENVAR
DKLREVTTGCDSCWVAHPALVPVVLKVFNEHMKGPNQINVPPKTPYKPVTARDLLSPFVP
GAKITEQGIRANIIIGLSYIEAWLRNVGCVPINYLMEDAATAEVSRTQIWQWVTHGATTD
TGVTVTKPYVQKLLKEEYTKLAQAAKPGNKFKPALAYFAPEASADRYSDFLTTLIYDDVT
TIGRALPGEKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccattcccacaaaccgtcgacaaagtcaagggcctcaagattttgggtccc
ctccctgaaggagccaaacacatcttcaatgttgaagctttggctttcgttgctactttg
caccgttcgttcaatgcccgtagaaaggaattgttagccaacagaaaggaagcccagagg
ttgagagactccggtaagttgcctgactttttgccagaaactgcctacatcagagatgat
gccacctggaccggacctccattggccaagggcttgcaggacagaagagttgaaatcacc
ggtcctactgacagaaagatggtgatcaatgccttgaactccaacgttgctacttacatg
gcagatttcgaagactcgttgactccagcttggaacaacttggtcgaaggtcaggttaac
ttgtacgacggtgtcagaagaaacttgacttttgaaaccaacggcaagaagtacgccttg
aaccttgaccccaagagacacatcccaaccttgattgtcagacccagaggctggcacttg
gaagaaaagcatgtcactgtggacggcgagccagtttcgggtggtatttttgactttgcc
atctacttctacaacaacgctgttgaatccttgaagcagggctttggaccatacttctac
ttgccaaagatggaacaccacttggaagccaagttgtggaatgacatcttcaactactcc
caggactacattggtattccaagaggtaccatcagagcctccgttttgattgagactttg
ccagctgccttccagatggacgaaatcatctaccaattaagacagcacattgccggcttg
aactgtggtagatgggactacatcttctcatacatcaagtcattgagaaaccaccctgaa
ttcatcttgccagacagatcccaagtgactatggctgctccatttatgtcatcttacgta
aagttgttggtgcacacatgtcataagagacaagtacatgccttaggtggtatggctgcg
cagattccaatcaaggacgatccagaaagaaacagattggctttggaaaacgttgccaga
gacaagttgagagaagtgaccactggttgcgactcctgttgggttgctcacccagccttg
gttcctgtcgtgttgaaggtcttcaacgagcacatgaagggtcctaaccagatcaatgtt
ccaccaaagactccatacaagcctgttactgcaagagacttgttgtcgccatttgttcca
ggtgccaagatcaccgaacagggtatcagagccaacatcatcattggtctctcgtacatt
gaagcctggttaagaaacgtcggctgtgttcctatcaactacttgatggaagatgctgcc
actgcagaagtgtctagaactcaaatttggcaatgggttacccacggtgctactacagac
accggagtcaccgtcaccaagccttatgtgcaaaagttgttgaaggaagaatacaccaag
ttggcccaggctgccaagccaggcaacaagttcaagccagctttggcctactttgcccca
gaagcttctgctgacaggtactctgatttccttacgactttgatctacgacgacgtcacc
accatcggcagagccttgccaggtgaaaaattgtag

DBGET integrated database retrieval system