KEGG   Scheffersomyces stipitis: PICST_53734Help
Entry
PICST_53734       CDS       T01023                                 

Gene name
eIF31
Definition
(RefSeq) Translation initiation factor eIF3, p35 subunit
  KO
K03245  translation initiation factor 3 subunit J
Organism
pic  Scheffersomyces stipitis
Pathway
pic03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_53734 (eIF31)
Ribosome biogenesis [BR:pic03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    PICST_53734 (eIF31)
Translation factors [BR:pic03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PICST_53734 (eIF31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 4851992
NCBI-ProteinID: XP_001386970
JGI: 53734
UniProt: A3GI93
Position
1
AA seq 263 aa AA seqDB search
MSWDDEDFDIPSKAPANVASASWEDEEDDDPILESWDIDEEEAELKKKQEEAKLKKLNAK
KGIRGVLDVDELDDDVRKELMKEEALRADLNNTADLFGGLGVSADDALEHPKERLNRAIL
AAQSKKPVLTKDTPLEEHPLFQPTNKQEYENLRKGVGSALTKLADDSIMNYSSSLAIDLI
RDLSVPLSVENLRKVISTLNVAIKDKEKAERLARLKKSGGTATGGAGKKKAKPAARPNVG
GGFMKDGLDEMDNYDDFGDDDFM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagattttgacattccttctaaggctccggccaacgtggcttct
gcctcctgggaagacgaagaagacgacgatcctattttggagtcgtgggacattgatgaa
gaagaagccgagctcaagaagaagcaggaagaagctaagctcaagaagttaaacgccaaa
aagggtattagaggagttttggacgttgacgaacttgacgacgatgtcagaaaggagttg
atgaaggaagaggccttgagagcagacttgaacaacactgccgatttatttggtggtttg
ggagtttcagccgatgatgctttggagcatccaaaggaaagattaaatagagccatcttg
gctgctcagagtaagaagccagtcttaaccaaagacactcctcttgaagagcatcctttg
ttccaacctacaaacaagcaagaatacgaaaacttgagaaaaggtgtaggttcggctttg
accaaattagctgacgattccatcatgaactactcttccagtttggctattgatttgatc
agagatctttcggtgcctttgtctgtggaaaacctcagaaaggtcatttctacgttgaat
gttgccattaaggacaaggaaaaggctgagagattggcaagattgaagaagagtggtggt
actgctactggtggtgctggtaagaaaaaggccaagcctgctgccagacctaacgttggt
ggtggcttcatgaaagatggtcttgatgaaatggacaactatgatgatttcggtgatgat
gatttcatgtga

DBGET integrated database retrieval system