KEGG   Scheffersomyces stipitis: PICST_53734Help
Entry
PICST_53734       CDS       T01023                                 

Gene name
eIF31
Definition
Translation initiation factor eIF3, p35 subunit
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pic  Scheffersomyces stipitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_53734 (eIF31)
Translation factors [BR:pic03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PICST_53734 (eIF31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 263 aa AA seqDB search
MSWDDEDFDIPSKAPANVASASWEDEEDDDPILESWDIDEEEAELKKKQEEAKLKKLNAK
KGIRGVLDVDELDDDVRKELMKEEALRADLNNTADLFGGLGVSADDALEHPKERLNRAIL
AAQSKKPVLTKDTPLEEHPLFQPTNKQEYENLRKGVGSALTKLADDSIMNYSSSLAIDLI
RDLSVPLSVENLRKVISTLNVAIKDKEKAERLARLKKSGGTATGGAGKKKAKPAARPNVG
GGFMKDGLDEMDNYDDFGDDDFM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagattttgacattccttctaaggctccggccaacgtggcttct
gcctcctgggaagacgaagaagacgacgatcctattttggagtcgtgggacattgatgaa
gaagaagccgagctcaagaagaagcaggaagaagctaagctcaagaagttaaacgccaaa
aagggtattagaggagttttggacgttgacgaacttgacgacgatgtcagaaaggagttg
atgaaggaagaggccttgagagcagacttgaacaacactgccgatttatttggtggtttg
ggagtttcagccgatgatgctttggagcatccaaaggaaagattaaatagagccatcttg
gctgctcagagtaagaagccagtcttaaccaaagacactcctcttgaagagcatcctttg
ttccaacctacaaacaagcaagaatacgaaaacttgagaaaaggtgtaggttcggctttg
accaaattagctgacgattccatcatgaactactcttccagtttggctattgatttgatc
agagatctttcggtgcctttgtctgtggaaaacctcagaaaggtcatttctacgttgaat
gttgccattaaggacaaggaaaaggctgagagattggcaagattgaagaagagtggtggt
actgctactggtggtgctggtaagaaaaaggccaagcctgctgccagacctaacgttggt
ggtggcttcatgaaagatggtcttgatgaaatggacaactatgatgatttcggtgatgat
gatttcatgtga

DBGET integrated database retrieval system