KEGG   Scheffersomyces stipitis: PICST_54239Help
Entry
PICST_54239       CDS       T01023                                 

Gene name
SPH1
Definition
Sphingosine kinase, involved in sphingolipid metabolism Lipid transport and metabolism
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pic  Scheffersomyces stipitis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pic00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 521 aa AA seqDB search
MTLHNNLSTERLIYHQQDSIRATLQDFGIQIDSQELLAIEDDSVDSTYSFCSWKSAPDNR
SRIPYRNILWVQPVIDETGQVQEDDLEITYVKPKGKLSLEPVTLRISIQNYRALYNNLQE
LSNSILAKSYKNHIVKPSVLVIINPHGGQGKALKIYNTEIKPILKAARAKITIQETSYHK
HGIDIGRELDISKYDVIACCSGDGIPHEIINGFYERPDKGVSAFNKIAITQLPCGSGNAL
SLSTHGSNDASMATFHMLKAKRTKLDLMAVTQGVGPNEKIKLSFLTQCYGVIADADIGTE
HLRWMGAIRFDVGVLHGILARRKFPCELYVDFLTNSKQELSAHFDTYHQNSNSTAARIEH
HSQDDGELPLLNEERLQVKGPKLNHPPPESWTKISQNISDNVNILYVGKMPYISNDVQFF
PAALPNDGSMDMILTDTKTSVMETASILMSLDKGLHVHNEKVHHAKISSYRLIPKIPRNE
QHYISVDGESFPFEPLQVEVLPGVLTGLLQGGNFVDTCFSR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccataataatctcagcacagaaaggctcatataccaccagcaggactccata
cgcgcgacgcttcaagacttcgggatccagattgattcccaggaattgctagcaattgag
gatgactctgtggacagtacatattcattttgcagctggaaatctgcacccgataaccgt
tcaagaattccatacagaaacatcctctgggtacagcctgtcattgatgaaacgggccag
gtccaagaagacgacttggaaatcacatacgtcaaaccaaagggcaagttgtcgctcgag
ccagtcaccttgcgtattctgatccaaaactaccgtgctctctataacaatctccaggaa
ttatctaattcaatactagctaaatcctacaagaaccatatcgtgaaaccgtcagtcttg
gtgattataaatcctcacggtggtcaaggaaaggctttgaagatctacaatacggaaata
aagccaattttaaaggcggccagagccaagattactattcaggaaacaagttaccacaag
catggaatcgatatcgggcgtgaactagatatctccaagtacgatgtaatagcatgttgt
tcaggagatggaatcccgcatgaaatcattaacggtttttacgaaaggccagataagggc
gtgtctgctttcaacaaaatagccatcacccaacttccgtgtggctctggtaatgccctt
tctctcagtacccatggaagtaatgatgcttccatggctacttttcatatgttaaaggca
aagagaactaagcttgacctcatggctgtgactcaaggtgtaggtcctaacgagaaaatc
aagttatccttcttgacgcaatgttatggtgttattgcggatgctgatattggcacggaa
catttgaggtggatgggggcgatcagatttgatgttggggttttacacggtattttggca
agaagaaagtttccctgtgaattgtatgtcgatttcttgaccaattcaaaacaagaactc
tctgcccatttcgacacttatcaccagaattcaaattcgacagcagctcgcatagaacat
cattcacaagatgatggtgaattgccactattgaatgaagagcggttgcaagtcaaggga
ccaaaattgaaccatccaccacctgaatcatggactaaaataagccaaaacatatcggac
aatgtcaacattctctacgtaggtaagatgccatatatttccaacgatgtccagtttttt
ccagcagctctaccaaatgacggatctatggacatgatcctcacagatactaaaacctct
gtaatggaaaccgcttccattctcatgtccttagacaagggattgcatgttcataacgaa
aaagtacatcatgctaagatttcgtcttacagattgattccaaagataccgcggaatgag
cagcattatatttcagtggatggagaaagttttccattcgaaccgttacaggtcgaagtt
ctaccaggagtactcacgggcttgctacaaggtggaaattttgttgatacgtgcttttca
cgttag

DBGET integrated database retrieval system