KEGG   Scheffersomyces stipitis: PICST_54239Help
Entry
PICST_54239       CDS       T01023                                 

Gene name
SPH1
Definition
Sphingosine kinase, involved in sphingolipid metabolism Lipid transport and metabolism
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pic  Scheffersomyces stipitis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PICST_54239 (SPH1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PICST_54239 (SPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 521 aa AA seqDB search
MTLHNNLSTERLIYHQQDSIRATLQDFGIQIDSQELLAIEDDSVDSTYSFCSWKSAPDNR
SRIPYRNILWVQPVIDETGQVQEDDLEITYVKPKGKLSLEPVTLRISIQNYRALYNNLQE
LSNSILAKSYKNHIVKPSVLVIINPHGGQGKALKIYNTEIKPILKAARAKITIQETSYHK
HGIDIGRELDISKYDVIACCSGDGIPHEIINGFYERPDKGVSAFNKIAITQLPCGSGNAL
SLSTHGSNDASMATFHMLKAKRTKLDLMAVTQGVGPNEKIKLSFLTQCYGVIADADIGTE
HLRWMGAIRFDVGVLHGILARRKFPCELYVDFLTNSKQELSAHFDTYHQNSNSTAARIEH
HSQDDGELPLLNEERLQVKGPKLNHPPPESWTKISQNISDNVNILYVGKMPYISNDVQFF
PAALPNDGSMDMILTDTKTSVMETASILMSLDKGLHVHNEKVHHAKISSYRLIPKIPRNE
QHYISVDGESFPFEPLQVEVLPGVLTGLLQGGNFVDTCFSR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccataataatctcagcacagaaaggctcatataccaccagcaggactccata
cgcgcgacgcttcaagacttcgggatccagattgattcccaggaattgctagcaattgag
gatgactctgtggacagtacatattcattttgcagctggaaatctgcacccgataaccgt
tcaagaattccatacagaaacatcctctgggtacagcctgtcattgatgaaacgggccag
gtccaagaagacgacttggaaatcacatacgtcaaaccaaagggcaagttgtcgctcgag
ccagtcaccttgcgtattctgatccaaaactaccgtgctctctataacaatctccaggaa
ttatctaattcaatactagctaaatcctacaagaaccatatcgtgaaaccgtcagtcttg
gtgattataaatcctcacggtggtcaaggaaaggctttgaagatctacaatacggaaata
aagccaattttaaaggcggccagagccaagattactattcaggaaacaagttaccacaag
catggaatcgatatcgggcgtgaactagatatctccaagtacgatgtaatagcatgttgt
tcaggagatggaatcccgcatgaaatcattaacggtttttacgaaaggccagataagggc
gtgtctgctttcaacaaaatagccatcacccaacttccgtgtggctctggtaatgccctt
tctctcagtacccatggaagtaatgatgcttccatggctacttttcatatgttaaaggca
aagagaactaagcttgacctcatggctgtgactcaaggtgtaggtcctaacgagaaaatc
aagttatccttcttgacgcaatgttatggtgttattgcggatgctgatattggcacggaa
catttgaggtggatgggggcgatcagatttgatgttggggttttacacggtattttggca
agaagaaagtttccctgtgaattgtatgtcgatttcttgaccaattcaaaacaagaactc
tctgcccatttcgacacttatcaccagaattcaaattcgacagcagctcgcatagaacat
cattcacaagatgatggtgaattgccactattgaatgaagagcggttgcaagtcaaggga
ccaaaattgaaccatccaccacctgaatcatggactaaaataagccaaaacatatcggac
aatgtcaacattctctacgtaggtaagatgccatatatttccaacgatgtccagtttttt
ccagcagctctaccaaatgacggatctatggacatgatcctcacagatactaaaacctct
gtaatggaaaccgcttccattctcatgtccttagacaagggattgcatgttcataacgaa
aaagtacatcatgctaagatttcgtcttacagattgattccaaagataccgcggaatgag
cagcattatatttcagtggatggagaaagttttccattcgaaccgttacaggtcgaagtt
ctaccaggagtactcacgggcttgctacaaggtggaaattttgttgatacgtgcttttca
cgttag

DBGET integrated database retrieval system