KEGG   Scheffersomyces stipitis: PICST_54293Help
Entry
PICST_54293       CDS       T01023                                 

Gene name
HSP78
Definition
Heat shock protein 78, mitochondrial precursor HSP78 (EC:3.6.1.3)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_54293 (HSP78)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     PICST_54293 (HSP78)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 750 aa AA seqDB search
MITQKRLFHSTIPKKLQMQQNEESDNRPALEKFGSDLTQMAKDGKLDPVIGRDEEIRRTI
QILSRRTKNNPVLIGNAGTGKTAIMEGLAQRILKGEVPDSMKDKKIITLDLAGIISGSKF
RGDFESKLKSILKEVEEQHGKVILFVDELHLLMGLGKAEGSIDASNLLKPALARGMLSLC
GATTIEEYRKYVEKDAALARRFSPVLVNEPTVQDTISILRGLKERYEVHHGVRITDGALV
TAALYSNRYITDRFLPDKAIDLVDEASSTLRLQHESKPDAIAQLDRDIMTIEIELESLRK
EEDQLSKDRRSKLEEELKVKKAELAEFTEQWETERRSIQDVKSAKTELEQSKFDLEQYQR
DGNYAKASELQYATIPELEEKLKSLTEKESANQSSNLLHDSVTSDDIASVISKMTGIPVN
NLLKGEKDKLLDMEIILKQKVVGQDEAIHAVSDAVRLQRAGLTSDKRPIASFMFLGPTGT
GKTELTKTLAEFIFNDTSSVIRFDMSEFQERHSVSRLIGSPPGYVGYEDSGELTEAVRRK
PYSVVLFDEFEKAHKDVSKLLLQVLDEGSLTDSHGKHIDFRNTIIVMTSNIGQEILLADQ
DAHEDGSISEGVKREITEVLKHYYPPEFLNRLDEVLIFNRLSKSSLKNILDIRLREISER
LDDKRIRLELTEEAKTLICDLGYDPIYGARPLNRVLQKQLLNPLALLLIKGQVKETETVS
IEAKSGKIFVRPNHDENIYDENGEKVGGEE
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgatcactcagaagagattgtttcatagtaccatcccaaagaaactccagatgcaacag
aatgaagaaagtgacaaccgtccggcgcttgaaaagtttggaagcgacctcacccagatg
gccaaagacggcaaattggatcccgtgatcggccgagatgaggaaattcgtcgtactatc
caaatcttgtctcgtagaacaaagaataacccagtccttatagggaatgccggtacgggt
aagactgccattatggaagggttagctcagaggattctcaagggtgaggttccagactct
atgaaggacaagaaaattatcactttggacttagcaggaatcatctctgggtccaagttc
agaggtgattttgaatccaaactcaaactgatactaaaagaggtggaggagcagcatggc
aaagtgattttgtttgtagatgaattgcatttgcttatgggtttgggcaaggctgaaggg
tcaattgatgcttccaacttgttgaaaccagctttagctagaggtatgctttctctctgt
ggagcaactactatcgaagagtatcgtaaatatgtggagaaagatgctgctcttgcaaga
agattctcacctgttcttgtaaacgagccgactgtgcaagataccatttcgatattgcgt
ggtttaaaggaacgttacgaagttcaccatggtgttcgtattactgatggtgccttagtg
actgctgctctctattcgaacaggtatatcaccgaccgtttcttgcctgataaggctatt
gacttagttgatgaagccagttcaactttgagattgcagcatgaatccaaacctgatgct
atcgctcaattagaccgtgacatcatgaccattgaaatcgaattggaatccttacgtaaa
gaagaggaccagttgtccaaggatcgtagaagtaagttggaagaagaattgaaggtgaag
aaggcggagttggccgagttcacagaacaatgggagactgaaagacggctgatccaagac
gtcaagagcgccaaaactgaattagaacaatcgaagttcgacttggaacaataccaaaga
gatggcaattatgccaaggcatctgaattacaatatgccaccatccctgaactcgaagaa
aagttgaagagcttgacggaaaaagaaagtgctaaccaatcgtcaaacttgttgcatgac
tcagtaacatccgacgacattgccagtgttatctccaagatgactggaattcctgtcaat
aacttgttgaaaggtgaaaaggacaagttactcgatatggaaattattttgaaacaaaag
gttgtaggacaggatgaagcaattcatgctgtttctgatgctgtaagacttcaaagagct
ggcttgactagtgacaagaggcccattgcctctttcatgttcttggggccaactggtaca
ggtaagactgagttgacgaagactttagcagagtttatcttcaacgatacttcctcggtt
atcagatttgacatgtccgagttccaggagagacattctgtttcaagattgatcggttcg
cctcctggatacgtcggttacgaagacagtggcgagttgaccgaggctgtcagaagaaag
ccatattcagtggttctttttgacgagttcgaaaaggctcataaggatgtctcgaagttg
ttattgcaggtattggatgaaggctccttgacggactctcatggaaaacatatagatttc
cgtaacacaatcattgtcatgacatctaacattgggcaggagatcttattggctgaccaa
gatgctcacgaagatggaagcatttccgaaggtgtcaagcgcgaaatcactgaagtgtta
aagcattactatccacccgaatttttgaatcgtcttgatgaagtgttgatttttaacaga
ttgtctaagtcttccttgaagaacattttggatattcgtttgagagaaattctggaaagg
ttggacgacaagcggatacgcctagagcttaccgaagaagccaaaactcttatctgtgat
cttggttatgatccaatctatggggcacgtccattgaacagagtcttacagaaacagtta
cttaacccattggctctccttttgatcaagggtcaggtcaaggaaaccgagactgtttct
atcgaagccaaatctggaaagatctttgttagacccaatcatgatgaaaacatctatgac
gaaaacggagaaaaagtgggtggtgaagagtga

DBGET integrated database retrieval system