KEGG   Scheffersomyces stipitis: PICST_54431Help
Entry
PICST_54431       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pic  Scheffersomyces stipitis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PICST_54431
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PICST_54431
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   PICST_54431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 385 aa AA seqDB search
MSSDGEFTRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSAVDKLTGQNVAVKKIMKPFST
SVLAKRTYRELKLLKHLKHENLITLDDIFLSPLEDIYFVNELQGTDLHRLLTSRPLEKQF
IQYFTYQILRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDLWSVGCILAEMIEGKPLFPGKDHVHQFSIITELLGSPPPDV
IDTICSENTLRFVQSLPHRDPIPFNERFAQCTHVEPEAIDLLAKMLIFDPKKRISAASAL
THPYMEPYHDPTDEPICETKFDWSFNDADLPVDTWRVMMYSEILDFHQIGGVGEEAGQSV
TQEEIAHIQQDGIQAPQQPQEQQVE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggacggagaattcacaagaacccaaatctttggcacggtctttgaaataacc
aacagatacaccgacttgaaccccgtgggcatgggagcatttggtttggtgtgttctgca
gtggacaagttgacgggccagaacgtcgccgtcaagaagatcatgaagccgtttctgaca
tcggtgttggccaagagaacttatagagagttgaagttgttgaaacacttgaagcacgag
aacttgatcacgttggacgacatcttcttatcgccgcttgaagacatctacttcgtcaac
gagttacaaggaacagacttacaccggttgttgacgtcgagaccgttggaaaagcagttc
attcaatactttacctaccagatcttgcgggggttgaagtatatccattcggccggtgtg
attcatcgtgatttgaagccttcgaacatcttgatcaatgaaaactgtgacttgaagatc
tgtgactttggcttggccagaatccaggatcctcagatgaccggatatgtgtctacaaga
tattaccgtgcaccggaaatcatgttgacgtggcagaagtacgacaccgaagtcgattta
tggtctgtgggctgtattttggcagagatgatcgaaggaaagccattgtttccgggcaaa
gaccacgtccaccagttctctatcatcacggaattattgggatcgcctccaccagacgtc
attgataccatttgttctgaaaacaccctcagattcgtacaatcgttgccccacagagat
cctattccgttcaatgaaagattcgcacaatgtacccatgtagagccagaagctattgac
ttgttagccaagatgcttatttttgaccccaagaagagaattagtgctgcttccgcttta
actcatccatacatggaaccttaccatgatcctaccgatgagcctatttgtgaaaccaag
tttgactggagtttcaacgatgctgacttgcctgtagacacatggagagtgatgatgtac
agcgagattctagattttcaccagataggtggtgtaggagaagaagctggtcagagtgta
actcaagaagaaatagcccatattcagcaggacggcattcaggccccacaacaaccccag
gaacagcaagtagaatag

DBGET integrated database retrieval system