KEGG   Scheffersomyces stipitis: PICST_55152Help
Entry
PICST_55152       CDS       T01023                                 

Gene name
HEM14
Definition
mitochondrial protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pic  Scheffersomyces stipitis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PICST_55152 (HEM14)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PICST_55152 (HEM14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 553 aa AA seqDB search
MSLASIPSNGKVAVIGAGVSGLSLAYFLSKLRPDVNIEIFEKESRVGGWIKSENLQIGSG
SQTQKLIFEKGPRTLRGVSPGTLLIVDILKQLNKAAEIEVITKTSPANKKYILSESRGIL
QVPDSIGSFFKFLFNSGLFNSQLVFGILKEPFRKKGPAGDESIDSFFLRRFGTGVLTNNV
VSAVMHGIVAGDTAHLSINTMFPKLKQLEQEHGSIIRGMVARAWASRKKAQEVLADENVP
KALQLYEKYISPEAHLDKMSISLKKYPMIRLNDGLEGFPASVYEYLAQQKKVNFNFNSDI
VALDPEKGSITFKNSSTAVFDHINTSTSANVLTKILPKTSAYDEVKRSLASIPYVSVFLV
NIYTPSGKLIPKNNHGFGFLVPKLSGNIDSNPDLLLGVIFDSDVEKNSVQMSTFATSPHI
NEGYSKITLMMGGHYYNDFSIPSNSRNLKIVKGLLSKYLDIDIDNYNFILRDEATLDDKK
IGLLTENDILISYNLHEKCIPQYTVGYNEAKETTLGVLEKLNSKLSFGGTLFGAGIGVPD
AVSNGLEIALKLK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcattggcaagtattccatctaatggtaaagtcgcagtaataggagccggagtttcg
ggactttctctagcctactttcttctgaaacttcgtccagatgtgaatattgaaatcttt
gagaaagaaagtcgggtgggtggttggataaagtcagaaaacttacaaattggatctggc
agtcagacgcaaaagctcatattcgaaaaggggccaagaactcttagaggagtaagtccg
ggcactcttcttatagtggatatattgaagcagcttaacaaggctgctgaaatagaggtg
ataaccaagacttctcctgccaacaaaaagtatatcttgagtgaatcgcgtggaatcttg
caagttccagatagcattgggagttttttcaagtttctctttaatagtggactcttcaat
tctcagctagtctttgggatattaaaagagcctttccggaaaaagggaccggctggtgat
gaatctatcgacagtttcttcttgaggagatttggcactggtgtgttgactaataatgtg
gtaagtgctgtaatgcacggaattgtagctggagacactgctcatttaagcattaacact
atgtttccaaaattgaagcaattggaacaagagcatggctctataattagaggcatggtt
gcaagagcctgggctagtagaaaaaaagcccaagaagttttagccgatgagaacgtgcct
aaggctcttcaattgtatgagaagtatatttcacctgaggctcatttagacaaaatgtcc
attagtcttaaaaagtaccccatgatcagattgaatgatggtttggaaggcttccctgct
tctgtatatgaatacttggctcaacagaagaaggtcaattttaatttcaacagtgacata
gtagccttggatccggaaaagggttcgataactttcaaaaatagttcaacggctgtattt
gaccacatcaacacctctaccagtgccaatgtcttgacaaagattctccccaaaactagt
gcctatgatgaagtgaagcgctcgctcgcttctatcccatatgttagtgttttcttagtc
aatatctacactccatcaggcaaattgatccctaaaaacaaccacggttttggcttcttg
gttcccaaactttctggaaatattgacagcaacccggatttacttttgggagtaattttt
gactcagatgtggaaaagaattctgtgcaaatgctgactttcgctacttctcctcatatt
aatgaaggatatagtaagattactttgatgatgggaggtcactactataacgacttcctg
atcccttccaatagcaggaatctaaagattgtgaaaggcttgctttcgaagtatttggat
atagacatcgataattacaatttcatcttgagggacgaagccacactagacgataagaaa
atcggtctattgactgaaaatgatatcctcatatcctacaatcttcacgaaaaatgcatt
ccccagtatactgtgggttacaatgaagccaaagagactacattgggtgttttggaaaaa
ctcaattcaaagctatcgtttggcggaacactttttggtgctggtattggagttccagac
gctgttagcaacggattggaaattgcattaaaactaaaataa

DBGET integrated database retrieval system