KEGG   Scheffersomyces stipitis: PICST_55602Help
Entry
PICST_55602       CDS       T01023                                 

Gene name
TAH13
Definition
(RefSeq) NADPH-ferrihemoprotein reductase
Organism
pic  Scheffersomyces stipitis
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_1 FAD_binding_1 NAD_binding_1 Flavodoxin_3
Motif
Other DBs
NCBI-GeneID: 4836701
NCBI-ProteinID: XP_001382236
JGI: 55602
UniProt: A3LMT4
Position
2
AA seq 603 aa AA seqDB search
MAEQVSSSDGVTILYGSETGNAEDYARYLSSRLEYYQISATLSALDDYPLKQLVTETRYL
IIICSTTGQGELPRNAKKFMKFLLKRKLPSDLLNHIHLSTLGLGDSSYVKFNYAIKKLHT
RLFQLGCSELSPRCEADEMSPQGVDGFYKEWESQLVDSLLKFFPNKIQLDDSMLSYPRNQ
VVIDNYADVVDTVSHSALVSQSRKSPEDTSLHFGILKKNERVTSADHFQDVRHVVIESDN
LKYCPGDTVALYPSNDDQSVDLLIQSQPHWVTIADKPLTIHGKLPTVDGGLIDTKYLTLR
SLLTHHLDIAAIPRRSFFFKLWHFVDSSTEDGVREQEKLKEFGGLEETDELYDYANRPRR
SILETILEFHQNLKIPIEYVFDLFPTINPRYFSIASRPSSTSVELVVAIVEYKTIIRRIR
RGLCSRWLKSLTLGDKLLFSVQKMDMVFSLPGLEKPPIIMVAPGTGIAPMKSLIEYVTSS
DKDQELYLFYGCRYKEKDYLFPKLWDSLSKSNKLNIFPCFSRDEGSKIHYVQDMLFHKSS
LVGDLILNRNAIVFVCGSSGKMPKQVKLTFSEILHKQGNLKENDVQQYLLDMENQCRYKE
DVW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcaagtgtcgagtctggatggagtgacaatactttatggatccgagacggga
aatgccgaagactacgctcgttatttgagtctgcgcctagaatactaccaaatcagtgca
actctttcagcactagatgattatccactaaagcagctagttacagaaacgagatacctt
atcataatatgctcgacgactggccagggtgaacttccaagaaatgcaaaaaagttcatg
aagtttcttctcaaacggaagcttccttctgatctacttaaccatattcatctttccaca
cttggcttgggagactcttcctatgtcaaatttaactatgccatcaagaagttacacact
cgtcttttccagttgggatgtagcgagctttcgcctcgatgtgaagctgacgagatgtcg
cctcaaggtgtagatggtttctacaaggaatgggaatcacagttggtggattcgttgcta
aagttcttccccaataaaattcaattggacgactctatgttatcatatccacggaatcaa
gtggttatagataactatgctgatgtagtggataccgtgtctcactctgcacttgtgtcc
caatcgagaaagctgcctgaagacacgtcattgcatttcggtatacttaagaaaaatgaa
cgggtcactagtgccgatcattttcaggatgtcaggcatgtcgtaattgagtcggacaac
ttgaaatactgtccaggtgataccgtagccttatatccgtccaatgacgaccaaagtgta
gatcttctaattcaactgcaaccgcattgggttacaatagcagataagcctttgacaatt
cacggaaaattgcccactgtcgatggtggacttatagatacaaagtatctcaccttgagg
tcacttttaacacaccacttggacattgcggctattccaagaagatcgttctttttcaaa
ttatggcattttgtagattcttcgaccgaggatggtgtacgtgaacaagaaaaacttaaa
gaatttggaggtcttgaggaaactgacgagttgtacgattatgcaaataggccaagacgg
ctgatattagaaaccattttggaatttcatcagaatttgaaaatacctattgagtacgtg
ttcgatttatttccaacaatcaacccgagatactttctgatagcatcaagacccagctca
acaagtgtagaattggtggttgcaatagtagagtacaagactataatccggcgtatccgt
agaggattatgttctaggtggttgaagctgctaacccttggtgataagctacttttctcc
gtccagaaaatggacatggtcttctcacttccgggattggaaaagccaccaataatcatg
gtagcaccaggcacaggtattgcgccgatgaaatctttaatagagtacgttacttccctg
gacaaagatcaggagttatatcttttctatggatgcagatacaaagaaaaggattatctc
tttcctaaattatgggatctgctcagcaagagtaacaagcttaatatattcccctgtttt
tctagagatgagggatcaaagatccattatgttcaagacatgcttttccacaaaagtctg
ttggtcggagacttgatcttgaatagaaatgcaattgtatttgtttgcgggtcaagtgga
aaaatgcctaaacaagttaagctaaccttcagcgagatcttacataagcagggcaatttg
aaagagaatgacgtgcaacagtatttattggatatggaaaaccaatgtagatacaaagag
gacgtatggtag

DBGET integrated database retrieval system