KEGG   Scheffersomyces stipitis: PICST_55602Help
Entry
PICST_55602       CDS       T01023                                 

Gene name
TAH13
Definition
NADPH-ferrihemoprotein reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 603 aa AA seqDB search
MAEQVSSSDGVTILYGSETGNAEDYARYLSSRLEYYQISATLSALDDYPLKQLVTETRYL
IIICSTTGQGELPRNAKKFMKFLLKRKLPSDLLNHIHLSTLGLGDSSYVKFNYAIKKLHT
RLFQLGCSELSPRCEADEMSPQGVDGFYKEWESQLVDSLLKFFPNKIQLDDSMLSYPRNQ
VVIDNYADVVDTVSHSALVSQSRKSPEDTSLHFGILKKNERVTSADHFQDVRHVVIESDN
LKYCPGDTVALYPSNDDQSVDLLIQSQPHWVTIADKPLTIHGKLPTVDGGLIDTKYLTLR
SLLTHHLDIAAIPRRSFFFKLWHFVDSSTEDGVREQEKLKEFGGLEETDELYDYANRPRR
SILETILEFHQNLKIPIEYVFDLFPTINPRYFSIASRPSSTSVELVVAIVEYKTIIRRIR
RGLCSRWLKSLTLGDKLLFSVQKMDMVFSLPGLEKPPIIMVAPGTGIAPMKSLIEYVTSS
DKDQELYLFYGCRYKEKDYLFPKLWDSLSKSNKLNIFPCFSRDEGSKIHYVQDMLFHKSS
LVGDLILNRNAIVFVCGSSGKMPKQVKLTFSEILHKQGNLKENDVQQYLLDMENQCRYKE
DVW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcaagtgtcgagtctggatggagtgacaatactttatggatccgagacggga
aatgccgaagactacgctcgttatttgagtctgcgcctagaatactaccaaatcagtgca
actctttcagcactagatgattatccactaaagcagctagttacagaaacgagatacctt
atcataatatgctcgacgactggccagggtgaacttccaagaaatgcaaaaaagttcatg
aagtttcttctcaaacggaagcttccttctgatctacttaaccatattcatctttccaca
cttggcttgggagactcttcctatgtcaaatttaactatgccatcaagaagttacacact
cgtcttttccagttgggatgtagcgagctttcgcctcgatgtgaagctgacgagatgtcg
cctcaaggtgtagatggtttctacaaggaatgggaatcacagttggtggattcgttgcta
aagttcttccccaataaaattcaattggacgactctatgttatcatatccacggaatcaa
gtggttatagataactatgctgatgtagtggataccgtgtctcactctgcacttgtgtcc
caatcgagaaagctgcctgaagacacgtcattgcatttcggtatacttaagaaaaatgaa
cgggtcactagtgccgatcattttcaggatgtcaggcatgtcgtaattgagtcggacaac
ttgaaatactgtccaggtgataccgtagccttatatccgtccaatgacgaccaaagtgta
gatcttctaattcaactgcaaccgcattgggttacaatagcagataagcctttgacaatt
cacggaaaattgcccactgtcgatggtggacttatagatacaaagtatctcaccttgagg
tcacttttaacacaccacttggacattgcggctattccaagaagatcgttctttttcaaa
ttatggcattttgtagattcttcgaccgaggatggtgtacgtgaacaagaaaaacttaaa
gaatttggaggtcttgaggaaactgacgagttgtacgattatgcaaataggccaagacgg
ctgatattagaaaccattttggaatttcatcagaatttgaaaatacctattgagtacgtg
ttcgatttatttccaacaatcaacccgagatactttctgatagcatcaagacccagctca
acaagtgtagaattggtggttgcaatagtagagtacaagactataatccggcgtatccgt
agaggattatgttctaggtggttgaagctgctaacccttggtgataagctacttttctcc
gtccagaaaatggacatggtcttctcacttccgggattggaaaagccaccaataatcatg
gtagcaccaggcacaggtattgcgccgatgaaatctttaatagagtacgttacttccctg
gacaaagatcaggagttatatcttttctatggatgcagatacaaagaaaaggattatctc
tttcctaaattatgggatctgctcagcaagagtaacaagcttaatatattcccctgtttt
tctagagatgagggatcaaagatccattatgttcaagacatgcttttccacaaaagtctg
ttggtcggagacttgatcttgaatagaaatgcaattgtatttgtttgcgggtcaagtgga
aaaatgcctaaacaagttaagctaaccttcagcgagatcttacataagcagggcaatttg
aaagagaatgacgtgcaacagtatttattggatatggaaaaccaatgtagatacaaagag
gacgtatggtag

DBGET integrated database retrieval system