KEGG   Scheffersomyces stipitis: PICST_57912Help
Entry
PICST_57912       CDS       T01023                                 

Gene name
DAO1
Definition
D-amino acid oxidase (EC:1.4.3.1)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_57912 (DAO1)
   00330 Arginine and proline metabolism
    PICST_57912 (DAO1)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    PICST_57912 (DAO1)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    PICST_57912 (DAO1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PICST_57912 (DAO1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     PICST_57912 (DAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 360 aa AA seqDB search
MTSKVVVVGAGVIGLTTALQLKRANPDYSISIVAHHLPGDLDIEYTSPFAGANWHSFASK
NDRELQELDKPGYWKFLELSNEPRSGVWITTNKSYVTEVEFNSKGRDPAKFVPWFKNFVK
NFKTIENSSELPDGIAFGYSFDGVVISVPIYLNYLLQENLGAGNSVRRISKISNIHEARD
LHSSGAKADIVVNATGGLANRIVGFKDDKRNFPVRGQVLLVRNNAKCEVSVEGFPELDNE
MLYLMPRKEGGCIIGGCFLENFASTDVDEQLTKRIIDRALKYVPEIVDPSYKNNPPKVDI
VRTQVGLRPFREGGARIEQDSDNGWLFHNYGAGGGGYQGSYGMSSKLVELIQKHVGNSKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaaaggttgtagttgtaggcgctggtgtcattggcttgacaacagccttacag
ctcaaacgagccaatcccgattactcgatctccattgttgctcaccatttgccaggagac
ttagatattgaatacacttctccatttgcgggagcgaattggcactcatttgccagcaaa
aatgacagagaacttcaggaactagataaacctggctactggaagtttttggagctctcc
aatgagccgagatccggtgtctggataactaccaacaagtcctatgttaccgaagttgaa
ttcaactctaaaggaagggaccctgccaaatttgttccctggttcaagaacttcgttaag
aatttcaaaactattgaaaattcttcagaactacctgatggtatagcctttgggtattcg
ttcgatggtgtagtcatctctgtgcctatctacttgaactatttgcttcaggagaatctt
ggggctggaaactctgtgagaagaatcctgaaaatttctaatatccatgaagctagggac
cttcactcttcaggagccaaagcagatattgtagtcaatgccacaggtggtttggccaat
cgtatcgttggtttcaaagacgataaacgtaatttcccagtccggggacaagttcttctt
gtcagaaataatgcaaaatgtgaagttagtgtagagggatttcctgaattggacaatgaa
atgttgtatctcatgcctcgaaaggaaggtggctgtattattggaggttgtttccttgag
aatttcgccagtactgatgtggatgaacaattgactaagagaattatcgatagggccctc
aagtatgtgccagagattgtagatccttcttacaagaacaatccccccaaagttgatatt
gtgaggactcaggtaggtttacgtccctttagagagggaggtgccagaattgagcaagat
agcgataatggttggctattccataactacggagctggaggaggaggataccaaggaagc
tatggaatgagttcaaaacttgttgaattaatacagaaacatgtgggcaatagcaagttc
tag

DBGET integrated database retrieval system