KEGG   Scheffersomyces stipitis: PICST_59020Help
Entry
PICST_59020       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PICST_59020
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PICST_59020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 792 aa AA seqDB search
VSTKFVDYWRSKNTRQQHTLLASVSIAASLFYYVLSPSLPWNRSTMFAKRPDKYTTGLIN
LRNDCFANSSVQAYSALPGLTDYLNKFITSFNELSAFAKSKNIDINNVIHHQRLSTKNGD
SSAASTSKFKNTISKFDISLHIGLADIIKKLQETQMASRTISVWTFLHVLEGIFNAKISR
SQHDAHELTQLINETLENENIKIKNLHKYIKTNLHTILGSRDTPSPRDYSTLDKIQVPEF
PFSGLTLSQLKCLKCLGVSTPNFAPFLMITLHTPQKSSSDIEDMLNDNKTESIEGYQCLK
CRIVAIINNENHMKRTIPDQDVKHINELKKLNNNSKLCINDDLPKELEDFIRDYNVGGVN
ISQITSTVFRHTQILKPPKIFGVHLSRSSFNGGNATRNPCKVSFKEHLTLSIGKEYHEQL
RQFQHQAEEEEEKQLESKIEVTAAHVLTRDVNDMEDEDVQREDVDVKGTEDVDVEANVVD
NGTSTDDAGEENDLEDNDTSSTSTEESMQPSVSTTATMQNSSITNASDKSRTINSAPISD
DQSEKLRDHFKKFKFNENDVYKYRLKAMIKHQGSHTQGHYECYKKKPLFVKDKDGNIFKL
FPEIIDDFNGDTTYDVVPATSSELASVSMRTSSEGTKSSINTGHSSLDKRRSSSNSSMGS
KDGNVRRRLSTMMGRRPSVFQADPEEAGIQEIVNSGSATPAELLVDEPREYFSAELASAA
ISKSVHDSQNSQHSDKVKMKKIPSAIKQPYWRISDSKVTEVSRSTMMLEMTSVYMLYYER
VDRKQIKHSQIV
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtctccactaagtttgtggactactggagatcaaagaacacacgccaacaacatacgttg
ctagccctggtctcaattgcggcttcgctcttctactacgtgcttctgccgtcacttcct
tggaaccgcagtactatgttcgcgaaaagacctgacaaatacactacgggcctaatcaac
ctacggaacgattgctttgccaactcgtccgtccaagcctatctggctcttcctggactt
accgactacttgaacaagttcatcaccagtttcaatgagctttcggcttttgcgaagtcg
aaaaatatcgacatcaacaatgtaatccaccaccagagactcagtacgaaaaatggagat
tccagtgcagcctcaacttcaaagttcaaaaatactatatccaagtttgacatctcgctc
catattgggctcgccgacatcatcaagaaactccaggaaacccagatggcatcacgaact
atatccgtatggacttttctccacgtactagagggtatcttcaatgcaaaaatatctcga
tcacaacatgatgcccatgaattgactcagcttatcaacgagacgttagagaatgaaaat
atcaaaatcaaaaacttgcacaagtacatcaagaccaatctccacaccattctcggactg
agggacactccttcaccgagagactactcgacattggacaagatccaggtgccagagttt
cccttctcggggttaactttgagccagctcaagtgtctcaagtgtcttggggtatctaca
ccgaactttgctccgttcttgatgatcacattgcacacgccacaaaaactgtctagtgac
atcgaagacatgttgaacgacaacaagacagagtccatagaaggctaccaatgcctcaag
tgtaggatcgtcgcgataataaataacgaaaaccacatgaagcgtaccattcctgatcaa
gatgtcaagcacatcaacgaactcaagaagttgaacaacaactccaaactttgtatcaat
gacgatttgccaaaagaattggaagacttcatccgcgattataacgtaggcggagttaat
atttcccagatcacttcgacagtgtttaggcatacgcagatcttgaagcctcccaaaata
ttcggtgtgcacctctctcgttcaagcttcaacggaggcaatgccacaaggaatccctgc
aaagtttcgtttaaagagcacttgacgttgtctataggtaaggagtaccacgagcagtta
agacaattccaacaccaggcagaggaagaggaggaaaagcagttggagtcgaaaatcgaa
gtcacggctgcacatgtcttaacccgcgatgtaaacgatatggaagacgaagacgtccaa
agagaagatgtcgatgttaaaggaacagaagatgtagatgttgaagctaatgtagtcgat
aatggcacttctacagatgatgctggagaagaaaacgatctagaagacaacgacacttcg
tctacttcaactgaagaatcgatgcagccctcagttagtaccacggccacgatgcagaac
agttcaattaccaatgcctccgacaagtctcgtaccataaacagcgctccaatttcagac
gaccaatcagaaaagttacgggaccacttcaaaaagttcaagttcaacgaaaatgacgtt
tacaagtacagactcaaagccatgatcaagcaccaaggctcgcacacccaaggtcactac
gagtgctacaagaagaagcctttgtttgtcaaggataaggacgggaacatattcaaattg
ttccccgagattattgacgattttaatggtgacacaacatacgatgtagttccggctacc
tcttctgagcttgcatcagtgtccatgaggacttcctcagaaggaaccaaatcatctatt
aacacgggtcattcttctttggacaaacgtagatcatctagcaatagctctatgggctcc
aaggatggaaacgttcgtcgtagactctccactatgatgggccgtcgtccatctgtgttc
caagctgatccggaggaagccggtattcaagagattgtcaactcagggtcggctactcca
gcagagttgttagtagatgagcctcgcgagtacttctcagctgagttggccctggctgct
attagcaaatcggtccacgattcgcagaatagccaacattcggataaggtcaagatgaag
aagattccttctgccataaaacaaccctactggagaatcagcgattccaaagtgactgag
gtaagtcgaagcacaatgatgcttgaaatgacaagtgtctacatgttgtactacgagaga
gtcgaccgcaaacaaatcaaacattcccaaatagtttag

DBGET integrated database retrieval system