KEGG   Scheffersomyces stipitis: PICST_59150Help
Entry
PICST_59150       CDS       T01023                                 

Gene name
SAD1
Definition
(RefSeq) secondary alcohol dehydrogenase (SADH1)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00071  Fatty acid degradation
pic00350  Tyrosine metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_59150 (SAD1)
  Lipid metabolism
   00071 Fatty acid degradation
    PICST_59150 (SAD1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PICST_59150 (SAD1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PICST_59150 (SAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C IGFBP
Motif
Other DBs
NCBI-GeneID: 4838558
NCBI-ProteinID: XP_001384580
JGI: 59150
UniProt: A3LUA4
Position
4
AA seq 353 aa AA seqDB search
MSIPKTQVAYGYVPGKKTIQCFPNHPVQTPGDNQVLLKIEAAGMCHSDHNILLSGPLAGG
KGEPKMVMGHEIAGQIVQVGKNLEKSDIYEIGGRFAVTIAKACGECEMCRGGVDNACGNS
VMAYGLNCDGGFQQYLLIDNLRTLLPIPEGMSYEDAAVSTDAVLTPFHAIQKVRDLLHPT
TKVLVQGLGGLGLNAVQILKSYNCNIVACDIKEESRELAKGLGAAETYANIGDSSHSIES
FDLCFDFVGIDITFKNSQSYVKNHGKIVMVGLGRYKLSTLNFELARRDVEIIFNFGGTSL
EQIECMKWISLGRIKPVAQVVDMEQLPNYMEKLANNAIKGRMVFRPNFRKSNL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcccaaaaacacaagttgcttacggttatgtccccggcaagaagacgattcaa
tgtttccccaaccacccagtgcagaccccaggagataaccaggttttgttgaagatcgag
gctgctggtatgtgccatagcgaccacaacatcctcctttctggccctcttgcaggcggt
aaaggtgaacctaagatggtaatgggtcatgagattgctggccagattgtccaagtcgga
aagaacctcgaaaaatccgatatctacgaaatcggtggccgcttcgctgtgacgatcgcc
aaagcatgtggagagtgtgagatgtgccggggaggtgtagataacgcttgtggaaattct
gtaatggcctacggattgaattgcgacggagggttccagcaatacttgttgatcgacaac
ttgagaacgttattgcctattccagaaggcatgagctacgaggacgctgctgtttctact
gatgccgtcttgactcccttccatgcaattcagaaagtcagagacttgctccatcccacc
acgaaagtgttggtccagggcttgggtggtcttggtttgaatgctgtccagatcttgaag
agctacaactgcaatatcgtcgcctgcgacatcaaggaagaaagtagagaattggccaag
ggccttggagcagcggaaacctacgccaacatcggggactccagtcattcaatagagagc
tttgacctctgttttgactttgtcggtattgacatcacctttaagaacagtcagagctac
gtaaaaaaccatggaaagatcgtaatggtgggcttgggaaggtacaagttgagcactttg
aacttcgagctcgcaagaagagatgtcgagattatcttcaatttcggaggcacttctttg
gagcaaattgagtgtatgaagtggatctccttgggcagaatcaagcctgtagcccaggtt
gtggacatggaacagttgcctaactacatggagaagttggccaacaacgctatcaaggga
agaatggttttcagacccaatttcagaaaatccaatttgtag

DBGET integrated database retrieval system