KEGG   Scheffersomyces stipitis: PICST_59732Help
Entry
PICST_59732       CDS       T01023                                 

Gene name
HEM4
Definition
Uroporphyrinogen-III synthase (UROS) (Uroporphyrinogen-III cosynthetase) (Hydroxymethylbilane hydrolyase [cyclizing]) (UROIIIS) (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pic  Scheffersomyces stipitis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PICST_59732 (HEM4)
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PICST_59732 (HEM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 259 aa AA seqDB search
MPKAKPVLLLKNASVPTDPYEGIFLENGFCPEFLPLLTHRHFDRERTLEYLRSSEFVDEI
PVFIITSQRAVEMLGDCLSSLEQEVKKKILSKIGYTVGPATFSVLKTLGFSSIRGGERAG
NGSKLAELIHEEVGDISTRMVFFTGVVRKDIIPRKLMEWNHNLQETVIYTTEVRDDVVKN
FTNYIERTSGGWIVFFSPQGTESIVEYIRNQRQSQFKLASIGPTTEEYLLENSIKPDITA
SKPHASSLYEAIVNSENTA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagcgaaaccggtactacttctcaagaatgctagtgtaccgacagatccgtac
gagggtatatttctcgagaacggcttttgtcctgagtttttaccacttttgactcatcgt
cacttcgacagggaacggactttggaatatctaagaagctcagaatttgtagacgagatc
ccggttttcatcataacgtcacagagggctgtcgaaatgttaggcgactgccttagtctg
cttgaacaagaagtaaagaagaagatcttatcgaagattggctatactgtgggaccagca
actttttcagtgttgaagacgttgggattcagcctgatcagaggcggagagcgcgctgga
aacggactgaagttggcagagttgatacatgaagaagttggagatatttctacaagaatg
gtgttcttcacaggagttgtcagaaaggatataatcccgagaaagctcatggaatggaat
cataacttacaggaaactgtgatctacacaacagaagtgcgagatgatgtagttaaaaac
tttaccaactacattgaacgaacttctggtggctggatcgtatttttcagtcctcaggga
acagagctgatagtggagtatatacgaaaccagcgacaaagccagttcaaactcgcttct
attggtcctaccacggaagagtatctcttggagaatagtataaagccagatattactgct
tctaaaccacacgcatcttcattgtatgaagcaatagttaattcagagaatacagcataa

DBGET integrated database retrieval system