KEGG   Scheffersomyces stipitis: PICST_60284Help
Entry
PICST_60284       CDS       T01023                                 

Gene name
FSH3
Definition
(RefSeq) dihydrofolate reductase (EC:1.5.1.3)
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PICST_60284 (FSH3)
   00670 One carbon pool by folate
    PICST_60284 (FSH3)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PICST_60284 (FSH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 278 aa AA seqDB search
MSFKGKILFLHGYTQTSSIFYAKTSALRKKLTKLNYKCVYLNGPLKLTPADLPSSDELSK
FSTVVSSEEETNYRAWWVKPHKGNDGISLEEAFDSIRNYIKKGEIIPDEDMKEQPEETEE
EAKLPVVGIVGFSQGAALGGIIAHKFKELFDAPSPKFFILYSGFKLDTSKKSGNSRYQSH
YPDSEESISFKFLHVYGELDTVVDETRALSLYEVTKTKSDLLKHPGGHFVPNSKLFVEQV
TNWIQIAEKEEEQGKEPEVKDEDDIDSLLDMMDSIGKA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaaggtaagatcttgtttctccacggatacacccagacttcgtccattttc
tatgcgaaaacctcggcgttaagaaagaagctcactaaacttaactacaaatgtgtctat
ctcaatggcccactcaagttgactccagctgacttgccatcttcagatgaactctccaaa
ttttccactgtagtctctagtgaagaggaaacaaactacagagcttggtgggtaaaacct
cacaaaggaaacgacggtattctgttggaagaagcttttgactcgattagaaattatatc
aagaaaggtgaaatcatccctgatgaagatatgaaagaacaacccgaagaaaccgaggaa
gaagctaaattaccagtagttggtatagttggattctcacaaggagcagcgttgggcgga
ataatagcccataaatttaaggagctttttgatgcaccctctcccaaattcttcatcttg
tattctggatttaagcttgatacttcaaagaaatctggaaatagccgttatcagctgcac
tatccagatctggaagagtcgatcagcttcaagtttttgcatgtctatggagaattggac
accgtggttgacgaaactagagcattgtctttgtatgaagttaccaagacgaagtcagat
ctcttaaaacacccaggtggacatttcgttcccaactccaaactctttgtagaacaggtt
accaattggattcaaatagccgaaaaagaggaggagcagggaaaggagccagaggtaaaa
gatgaagatgatatagactctctattggacatgatggatagcattggaaaggcataa

DBGET integrated database retrieval system