KEGG   Scheffersomyces stipitis: PICST_60284Help
Entry
PICST_60284       CDS       T01023                                 

Gene name
FSH3
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pic00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pic00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 278 aa AA seqDB search
MSFKGKILFLHGYTQTSSIFYAKTSALRKKLTKLNYKCVYLNGPLKLTPADLPSSDELSK
FSTVVSSEEETNYRAWWVKPHKGNDGISLEEAFDSIRNYIKKGEIIPDEDMKEQPEETEE
EAKLPVVGIVGFSQGAALGGIIAHKFKELFDAPSPKFFILYSGFKLDTSKKSGNSRYQSH
YPDSEESISFKFLHVYGELDTVVDETRALSLYEVTKTKSDLLKHPGGHFVPNSKLFVEQV
TNWIQIAEKEEEQGKEPEVKDEDDIDSLLDMMDSIGKA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaaggtaagatcttgtttctccacggatacacccagacttcgtccattttc
tatgcgaaaacctcggcgttaagaaagaagctcactaaacttaactacaaatgtgtctat
ctcaatggcccactcaagttgactccagctgacttgccatcttcagatgaactctccaaa
ttttccactgtagtctctagtgaagaggaaacaaactacagagcttggtgggtaaaacct
cacaaaggaaacgacggtattctgttggaagaagcttttgactcgattagaaattatatc
aagaaaggtgaaatcatccctgatgaagatatgaaagaacaacccgaagaaaccgaggaa
gaagctaaattaccagtagttggtatagttggattctcacaaggagcagcgttgggcgga
ataatagcccataaatttaaggagctttttgatgcaccctctcccaaattcttcatcttg
tattctggatttaagcttgatacttcaaagaaatctggaaatagccgttatcagctgcac
tatccagatctggaagagtcgatcagcttcaagtttttgcatgtctatggagaattggac
accgtggttgacgaaactagagcattgtctttgtatgaagttaccaagacgaagtcagat
ctcttaaaacacccaggtggacatttcgttcccaactccaaactctttgtagaacaggtt
accaattggattcaaatagccgaaaaagaggaggagcagggaaaggagccagaggtaaaa
gatgaagatgatatagactctctattggacatgatggatagcattggaaaggcataa

DBGET integrated database retrieval system