KEGG   Scheffersomyces stipitis: PICST_62080Help
Entry
PICST_62080       CDS       T01023                                 

Gene name
ICL1
Definition
Isocitrate lyase (Isocitrase) (Isocitratase) (ICL)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:pic01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pic00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 549 aa AA seqDB search
MPYTAIDINEEEQFFQQQVKEINEWWSQPRWRKTKRIYTAEDIAKKRGTLKIEYPSSDQA
KKLFKLLGEHDKQKSVSFTFGALDPIHVAQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLGLSKAERAKLPYIDFLRPIIADADTGHGGI
TAIIKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADILGS
DLLAVARTDSEAATLITSTIDHRDHYFVVGATNPNSPELAALMSEAEAKGIYGEKLAAIE
AEWTKTAGLKLFHEAVIDTINAGNYSNKAALIKKFTDKVNPLSGTSNKEARKLAKELTGK
DIYFNWEVSRAREGYYRYRGGTQCAVMRGRAYAPYADLIWMESALPDYNQAKEFADGVKA
KWPEQWLAYNLSPSFNWNRAMPPNEQETYIKRLGKLGYVWQFITLAGLHTTALAVDDFSA
QYAKIGMRAYGQAVQQPEIEKGVEVVKHQKWSGAEYIDGLLKMVSGGVTSTAAMGAGVTE
DQFKDKAKY
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccttacactgctatcgacatcaacgaagaagaacaattcttccaacaacaggtcaag
gagatcaacgaatggtggtcccaacctcgttggagaaagacgaagagaatctataccgct
gaagacatagccaagaagagaggtacattgaagattgaatatccatcttctgaccaagcc
aagaagctcttcaagttgttgggagaacatgacaagcaaaagtctgtttccttcactttt
ggtgcattggacccaatccacgttgctcagatggccaaatacttggactctatctacgtt
tctggatggcaatgttcttccactgcttccacttctaacgaaccttccccagatttggct
gactaccctatggacactgttccaaacaaggttgaacacttgtggttcgctcaattgttc
cacgacagaaagcagagagaagaaagattgggactttcgaaggctgaaagagccaagttg
ccatacattgacttcttgagaccaattattgccgatgccgacactggtcacggtggtatc
actgccatcatcaaattgactaagttgttcgttgaaagaggtgctgctggtattcacatt
gaagatcaggctccaggtactaagaagtgtggtcacatggccggtaaggtcttggttcca
gtccaagaacacatcaacagattggttgccatcagagcctcggctgatatcttgggttcc
gacttgttggctgttgccagaactgactctgaagctgctaccttgatcacttccactatt
gaccacagagatcactactttgttgtcggtgccactaaccccaactcgccagaattggct
gctttgatgtctgaggctgaagctaagggtatctacggtgagaagttggctgctattgaa
gccgaatggaccaagacagctggcttgaagttgttccacgaagccgtcattgacaccatc
aatgcaggcaactactcaaacaaggctgcattaatcaagaagttcactgacaaggttaac
ccattgtcgggtacttccaacaaggaagccagaaaattggccaaggaattgaccggcaaa
gacatctacttcaactgggaagtttccagagccagagaaggttactacagatacagaggt
ggtactcaatgtgctgtcatgagaggtagagcctacgctccatacgctgacttgatctgg
atggagtcggccttgccagactacaaccaagccaaggaatttgctgacggtgtcaaggcc
aagtggccagaacaatggttggcttacaacttgtctccatcgttcaactggaacagagcc
atgcctcctaacgaacaggaaacctacatcaagagattgggtaagcttggttacgtctgg
caattcatcaccttggccggtttgcataccactgccttggctgttgatgacttctctgcc
caatacgccaagattggtatgagagcctacggacaagctgtgcaacagccagaaatcgaa
aagggtgttgaagtcgtcaagcatcaaaaatggtctggtgccgaatacattgacggtttg
ttgaaaatggtctctggaggtgtcacttcaactgctgctatgggtgctggtgtcaccgaa
gatcagttcaaggacaaggccaagtactaa

DBGET integrated database retrieval system